SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003931 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003931
Domain Number 1 Region: 1198-1273
Classification Level Classification E-value
Superfamily Immunoglobulin 3.33e-18
Family I set domains 0.016
Further Details:      
 
Domain Number 2 Region: 1295-1379
Classification Level Classification E-value
Superfamily Immunoglobulin 9.09e-17
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 889-952
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000741
Family I set domains 0.049
Further Details:      
 
Domain Number 4 Region: 1408-1489
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000001
Family I set domains 0.0095
Further Details:      
 
Domain Number 5 Region: 670-729
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000222
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Domain Number 6 Region: 1541-1608
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000288
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 7 Region: 784-850
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000575
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 8 Region: 433-493
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000131
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 9 Region: 530-584
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000458
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 10 Region: 33-82
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000693
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 11 Region: 377-438
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000785
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 12 Region: 729-789
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000366
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 13 Region: 1670-1726
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000863
Family TSP-1 type 1 repeat 0.006
Further Details:      
 
Domain Number 14 Region: 297-360
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000288
Family TSP-1 type 1 repeat 0.0059
Further Details:      
 
Domain Number 15 Region: 611-667
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000235
Family TSP-1 type 1 repeat 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000003931
Domain Number - Region: 1608-1667
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000118
Family TSP-1 type 1 repeat 0.008
Further Details:      
 
Domain Number - Region: 1487-1546
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00034
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003931   Gene: ENSMPUG00000003963   Transcript: ENSMPUT00000004002
Sequence length 1763
Comment pep:novel scaffold:MusPutFur1.0:GL897013.1:122896:506461:-1 gene:ENSMPUG00000003963 transcript:ENSMPUT00000004002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERCRRRATPGTPLLFLAFLLLSSRTARSEEDRDGLWDAWGPWSECSRTCGGGASYSLRR
CLSSKSCEGRNIRYRTCSNVDCPPEAGDFRAQQCSAHNDVKHHGQFYEWLPVSNDPDNPC
SLKCQAKGTTLVVELAPKVLDGTRCYTESLDMCISGLCQIVGCDHQLGSTIKEDNCGVCG
GDGSTCRLVRGQYKSQLSATKVDDTVVAVPYGSRHIRLVLKGPDHLYLETKTLQGAKGEN
SLSSTGTFLVDNSSVDFQKFPDKEILRMTGPLTADFIVKIRNSGPADSTVQFIFYQPIIH
RWRETDFFPCSATCGGGYQLTSAECYDLRSNRVVADQYCHYYPENVKPKPKLQECNLDPC
PASDGYKQIMPYDLYHPLPRWEATPWTACSSSCGGGIQSRAVSCVEEDIQGHVTSVEEWK
CMYTPKMPIVQPCNIFDCPKWLAQEWSPCTVTCGQGLRYRVVLCIDHRGMHTGGCSPKTK
PHIKEECIIPTPCYKPKEKLPVEAKLPWYKQAQELEEGAAVSEEPSFIPESWSACTVTCG
VGTQVRTVRCQVLLSFSQSVADLPADECEGPKPASQRACYAGPCQGDAPELNPEETDGLF
GVLQDLDELYDWEYEGFTTCSESCGGGVQEAVVSCLNKQTREPADENLCVTSRRPPRLLK
SCSLEPCPARWEIGKWSPCSLTCGVGLQTRDVFCSHLLSREMNETVILADELCRQPKPST
VQACNRFNCPPAWYPTQWQPCSRTCGGGTQKREVLCKQRMADGSFLELPETFCSTSKLAS
QQACKKDDCPSEWLLSDWTECSTSCGEGTQTRSAICRKVLKTGLSAIVNSSLCPPLPFSS
AIRPCMLATCARPGRPSTKHSPHIAAARKIYIQTRRQRKLHFVVGGFAYLLPKTAVVLRC
PTRRFRKPLITWEKDGQHLISSAHVTVAPFGYLKIHRLKPSDAGIYTCSAGPAREQFVIK
LLGGNRKLVARPLSLRGEEEAPAVRKAGPKEALQTHKHQNGIFSNGSKAEKRGPAGDLGS
RYDDLVSRLLEQGGWPGELLASWEVQDSTERNTSSEEDQNAEQALWHLPFTMVAEQRRLD
DILRNLSQQPEELRDVYGKHLVAQLAQEIFRSHMEHQDVLLKPSERRMPPVAISPHKHVS
GFSSSLRTSAAGEAAGGSRRPHRKPTILRKISAAQQLSASEVVTHLGQTVALASGTLSVL
LHCEAIGNPRPTISWARNGEEVQFSDRILLQPDDSLQILAPVEADVGFYTCNATNALGYD
SVSIAVTLAGKPLVKTSRGTVINTEEAAITVDVGSTIKTVQGVNVTINCQVAGVPEAEVT
WFRNKSKLGSPPHGHEGSLLLTDVSPSDQGLYSCRAANVHGELTENTQLLILDPPQVPTQ
LEDLRALLSATGPNLPSVLTSPLGAQLVLDPGNSALVGCPIKGHPTPNITWFHGGQPVAT
VPGLTHHILAAGQILQVANLSGGSQGEFSCLAQNEAGVLVQKASLVIQDYWWSVDRLATC
SASCGNRGVQQPRLRCLLNSTEVSPTHCAGKVRPAVQPIACNRRDCPSRWMVTSWSACTR
SCGGGVQTRRVTCQKLKASGISTPVSNDLCTQLAKRPVDTQACNQQLCVEWAFSSWGQCN
GPCIGPHLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWSLCT
ATCGNYGFQARRVECVHAHTNKAVPEHLCSWGPRPANWQRCNITPCENMECRDTTRYCEK
VKQLKLCQLSQFKSRCCGTCGKA
Download sequence
Identical sequences M3XXY0
XP_004765758.1.14098 ENSMPUP00000003931 ENSMPUP00000003931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]