SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003957 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003957
Domain Number 1 Region: 8-98
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.75e-17
Family PWWP domain 0.0000282
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003957   Gene: ENSMPUG00000003989   Transcript: ENSMPUT00000004028
Sequence length 209
Comment pep:novel scaffold:MusPutFur1.0:GL897177.1:443789:452387:1 gene:ENSMPUG00000003989 transcript:ENSMPUT00000004028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEAAVKSTANKYQVFFFGTHETAFLGPKDLFPYEESKEKFGKPNKRKGFSEGLWEIENN
PTVKASGYQSAPKKSSVDEPEPEPEAAEGYGDKKGSAEGSSDEEGKLVIDEPAKEKNEKG
ALKRRAEDTLEDSPKRPKEAEDPEGEEKEVAPLEGERPLPVEVENSTPSEPSSGRGPPQE
EEEEEEEEEEEEAAQEDAEAAGIRDHESL
Download sequence
Identical sequences M3XY06
ENSMPUP00000003957 ENSMPUP00000003957 XP_012904485.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]