SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003960 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003960
Domain Number 1 Region: 9-214
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.11e-67
Family BAR domain 0.0000000063
Further Details:      
 
Domain Number 2 Region: 257-320
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-23
Family SH3-domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003960   Gene: ENSMPUG00000003993   Transcript: ENSMPUT00000004032
Sequence length 325
Comment pep:known scaffold:MusPutFur1.0:GL897013.1:1136598:1184266:-1 gene:ENSMPUG00000003993 transcript:ENSMPUT00000004032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLLIGCSLFEKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMINTMSKIRGQEKGPGYP
QAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDMEVKQNFIDPLQNLH
DKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEM
DIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMTLEFTT
GDSTQPNGGLSHTGTPKPAGAPMDQPCCRALYDFEPENEGELGFKEGDVITLTNQIDENW
YEGMLHGQSGFFPINYVEILVALPH
Download sequence
Identical sequences M3XY09
ENSMPUP00000003960 XP_012918569.1.14098 ENSMPUP00000003960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]