SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003983 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003983
Domain Number 1 Region: 223-501
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.61e-75
Family Protein kinases, catalytic subunit 0.000000000154
Further Details:      
 
Domain Number 2 Region: 490-547
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000147
Family SH3-domain 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000003983
Domain Number - Region: 1024-1060
Classification Level Classification E-value
Superfamily UBA-like 0.00016
Family UBA domain 0.042
Further Details:      
 
Domain Number - Region: 108-170
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0349
Family SAM (sterile alpha motif) domain 0.011
Further Details:      
 
Domain Number - Region: 1062-1097
Classification Level Classification E-value
Superfamily UBA-like 0.0661
Family UBA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003983   Gene: ENSMPUG00000004016   Transcript: ENSMPUT00000004055
Sequence length 1105
Comment pep:novel scaffold:MusPutFur1.0:GL896912.1:14703636:14729183:1 gene:ENSMPUG00000004016 transcript:ENSMPUT00000004055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEARPLRTVTLRLPVPPEGRGLREGSAPLPGPSARSVGAMGERSAYQRLAGGEEGPQSP
SDLVRGSIFVEMPAARRFPGLELSFPLLARLRRRLYTRLGSSSMQPEEGTGWLLELLSEV
QLQQYFLRLRDDLNVTRLSHFEYVKNEDLEKIGMGRPGQRRLWEAVKRRKAMCKRKSWMS
KVFSGKRLEAEFPPHHSQSTFRKTSPTPGGPAGEGPLQSLTCLIGEKDLHLFEKLGDGSF
GVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVL
TPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARN
LLLAARDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFG
VTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPT
FVALRDFLLEAQPTDMRALQDFEEPDKLHIQMNDVITVIEGRAENYWWRGQNTRTLCVGP
FPRNVVTSVAGLSAQDISQPLQNSFIHTGHGDSDPRHCWGFPDKIDELYLGNPMDPPDLL
SVELSTSRPTQHLGRVKRQPPPRPPQPAIFAQKPTYDPVSEDQDPLSSDFKRLGLRKPAL
TRGLWLAKPSARVPGTKAARGSGGEVTLIDFGEEPVVPAPRPCAPSLAQLAMDACSLLDK
TPPQSPTRALPRPLHPTPVVDWDARPLPPPPAYDDVAQDEDDFEVCSINSTLVGAGVCAG
PSQGETNYAFVPEQAPLLPPLEDNLFLPPQAGVKPPSSAQTAQIFQALQQECMRQLQVPA
ASLGPSPGPAPVGSRTPSPLVPPGSSPLPARLSSSPGKTMPTTQSFASDPKYATPQVIQA
PGPRVGPCILPIVRDGKKVSSTHYYLLPERPPYLERYQRFLREAQSPEEPAPLPVPLLLP
PPSTPAPAAPTATVRPMPQAAPDPKANFSTNNSNPGARPPALRATARLPQRGCPGDGPEA
GRPADKIQMLQAMVHGVTTEECQAALQSHSWSVQRAAQYLKVEQLFGLGLRPRSECHKVL
EMCDWSLEQAGCRLLGSCGPAHHKR
Download sequence
Identical sequences M3XY32
ENSMPUP00000003983 ENSMPUP00000003983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]