SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003985 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003985
Domain Number 1 Region: 1-287
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.72e-79
Family FCH domain 0.00000000871
Further Details:      
 
Domain Number 2 Region: 464-537
Classification Level Classification E-value
Superfamily SH3-domain 5.25e-17
Family SH3-domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000003985
Domain Number - Region: 342-410
Classification Level Classification E-value
Superfamily HR1 repeat 0.00562
Family HR1 repeat 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003985   Gene: ENSMPUG00000004018   Transcript: ENSMPUT00000004057
Sequence length 547
Comment pep:novel scaffold:MusPutFur1.0:GL896933.1:5156252:5256936:-1 gene:ENSMPUG00000004018 transcript:ENSMPUT00000004057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWGTELWDQFDSLDKHTQWGIDFLERYAKFVKERIEIEQNYAKQLRNLVKKYCPKRSSK
DEEPRFTSCIAFFNILNELNDYAGQREVVAEEMAHRVYGELMRYAHDLKTERKMHLQEGR
KAQQYLDMCWKQMDNSKKKFERECREAEKAQQSYERLDNDTNATKADVEKAKQQLNLRTH
MADENKNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERKV
IPIISKCLEGMILAAKSVDERRDSQMVVDSFKSGFEPPGDFPFEDYSQHIYRTISDGTIS
ASKQESGKMDAKTTVGKAKGKLWLFGKKPKGPALEDFSHLPPEQRRKKLQQRIDELNREL
QKESDQKEALNKMKDVYEKNPQMGDPGSLQPKLAETMNNIDRLRMEIHKNEAWLSEVEGK
TGGRGDRRHSSDINHLVTQGRESPEGSYTDDANQEVRGPTQQHGHHSEFDDEFEDDDPLP
AIGHCKAIYPFDGHNEGTLAMKEGEVLYIIEEDKGDGWTRARRQNGEEGYVPTSYIDVTL
EKNSKGS
Download sequence
Identical sequences M3XY34
ENSMPUP00000003985 ENSMPUP00000003985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]