SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004048 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004048
Domain Number 1 Region: 15-278
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 7.85e-37
Family Patatin 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004048   Gene: ENSMPUG00000004082   Transcript: ENSMPUT00000004121
Sequence length 565
Comment pep:novel scaffold:MusPutFur1.0:GL897054.1:3008062:3053428:1 gene:ENSMPUG00000004082 transcript:ENSMPUT00000004121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEQVFKGDPDTPHSISFSGSGFLSFYQAGAVDAFRDLAPRMLETTHRFAGTSAGAVIAA
LVICGIEMDEYLRVLNVGVAEVKKSFLGPLSPSCKMVQMMRQFLYRVLPEDSYKAATGKL
HVSLTRFTDGESVVVSEYTSKEELIEALYCGCFVPVYCGLIPPTYRGVRYIDGGFTGMQP
CSFWTDAITISTFSGQQDICPRDCPAIFHDFRMFNCSFQFSLENIARMTHALFPPDLLIL
HNYYYRGYEDTVSYLRRLNAAYLNSPSKRVMFPRVEVYCNIELALGSECPEHSQSSLQTE
QEESIQPHTQWAPEGEGKSCHSPLVSSPVQTPESTHEWPVESPVSPLVSSFEQSPASPLA
SSPSHSPADLPPVSRPAVPLPLSSTPVLSHISPPQQRVQTTGSSPRSPPSQSPLSPRPFL
GSSSVGTSQTLPLCSSVSPGQPPVEELGPEQPQAPLASSNLKDAMPLVNVKEATSKPHIT
GNPAEDSNWMSKMFKKNKQKTSSTRISFPRHPRSKKTGGKLQSAPCPLDFSLLSTSETVW
VTYRPHPSWIQEYSDPEEAVNQERT
Download sequence
Identical sequences M3XY97
ENSMPUP00000004048 XP_004770777.1.14098 XP_012900224.1.14098 ENSMPUP00000004048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]