SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004100 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000004100
Domain Number - Region: 205-253
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.068
Family TSP-1 type 1 repeat 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004100   Gene: ENSMPUG00000004134   Transcript: ENSMPUT00000004173
Sequence length 340
Comment pep:known scaffold:MusPutFur1.0:GL897134.1:1176215:1181407:-1 gene:ENSMPUG00000004134 transcript:ENSMPUT00000004173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPAAGALLWALLLSLGPRAAGAQGLTSTETQRVSFRLGVPMSRHYRTTLRTGGPRRMKV
TMEDEDDVGATVERLAGPAAAELLASTVATGVSKSIVSSAEEDESLEEGVVINARKNNIT
AASFSRGYNTARVPSSKFKANTQEKEIRMSTDVPANTWQPTGGEIQHPDSTMSQWSTAGS
TPNRWQQPSHTAMPPPEDLRLVLMPWGPWHCHCRSGTMSRTRSGKLQGLSGRLRVGALNQ
LRTEHRPCTYEKCPCNRLREECPLDSSLCSDTSCTTQTTTTPTTPLSSRIRPTPFLFFGP
SPSPSPALAFWRRVRIGLEDIWNSLSAVFTEMEPLEKNRR
Download sequence
Identical sequences M3XYE9
ENSMPUP00000004100 ENSMPUP00000004100 XP_004776821.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]