SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004103 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004103
Domain Number 1 Region: 203-337
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 5.89e-17
Family CRAL/TRIO domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004103   Gene: ENSMPUG00000004137   Transcript: ENSMPUT00000004176
Sequence length 356
Comment pep:novel scaffold:MusPutFur1.0:GL897134.1:1182309:1190288:-1 gene:ENSMPUG00000004137 transcript:ENSMPUT00000004176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTTQEAGEKTLDLGAGENAEAAHPAASLRLGELELKEEWQDEEFPRFLPEEADPSEGSD
DPERVSQAGTPSTLALCGPRPMRKRLSAPELQLNLTKGIGGDGTSPTNSVPSSPDGSSDL
EVDELETPSDSEQLDSGHEFEWEDDLPRAEGLGASEAVERLGRGCVWDVAGEDGRHWRVF
RTGMREQRVDMTVIELYKKVLSHGGYHGDGLNAVIVFSSCYLPSSSIPNYTYVMEHLFRY
MVGTLELLVAENYLLVHLSGGTSRAQVPPLGWMRQCYRVLDRRLRKNLRALVVVHATWYV
KTFLALLWPFISSKFTRKIRFLNSLGELAQLISLDQVHIPEAVRQLDRELHGSRGT
Download sequence
Identical sequences M3XYF2
ENSMPUP00000004103 ENSMPUP00000004103 XP_004776825.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]