SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004221 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000004221
Domain Number - Region: 10-37
Classification Level Classification E-value
Superfamily HIN-2000 domain-like 0.0288
Family HIN-200/IF120x domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004221   Gene: ENSMPUG00000004256   Transcript: ENSMPUT00000004297
Sequence length 55
Comment pep:novel scaffold:MusPutFur1.0:GL896927.1:7669102:7681011:1 gene:ENSMPUG00000004256 transcript:ENSMPUT00000004297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGNPKLRGKGEVCVPGSPKDIRPKDGGRLRLVCHPELKTMGKEKEDKSQEEEK
Download sequence
Identical sequences M3XYS0
ENSMPUP00000004221 ENSMPUP00000004221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]