SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004239 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004239
Domain Number 1 Region: 261-459
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.74e-47
Family Reprolysin-like 0.0021
Further Details:      
 
Domain Number 2 Region: 553-603
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000575
Family TSP-1 type 1 repeat 0.0004
Further Details:      
 
Domain Number 3 Region: 972-1022
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000562
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 4 Region: 911-969
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000107
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 5 Region: 849-907
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000235
Family TSP-1 type 1 repeat 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004239   Gene: ENSMPUG00000004274   Transcript: ENSMPUT00000004315
Sequence length 1215
Comment pep:novel scaffold:MusPutFur1.0:GL897046.1:4027352:4098377:-1 gene:ENSMPUG00000004274 transcript:ENSMPUT00000004315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLRALLSCLLPLHYALCAAAGSRTPELRLSGKLRDYGVTVPCSTDFQGRFLSHVLSGP
AAASAGSTVAEGPPAPQSHSGPLRVARSLPRPEGATLHPGQAGRPSLYFNVTVFGEELHL
RLRPNRRLVVPGASVEWQEDFRELFRQPLRRECVYTGDVMGMPGAAVAISNCDGLAGLIR
TDSSDYFIEPLEWGQQEQEASGRTHVVYRREVRQQEWAEPGGDLHNEAFGLGDLPNLLGL
VGQPLGNGERKRRHAKAGSYSIEVLLVVDDSVVRFHGKEHVQNYVLTLMNIVDEIYHDES
LGAHINIALVRLIMVGYRQSLSLIERGNPSRSLEQVCRWAHSQQRQDPSHSEHHDHVVFL
TRQDFGPSGYAPVTGMCHPLRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQGNGCADET
SLGSVMAPLVQAAFHRFHWSRCSKVELSRYLPSYDCLLDDPFVPTWPRPQELPGVDYSMD
EQCRFDFGSGYHTCSAFQTFEPCKQLWCSRPDNPYFCKTKKGPPLDGTECAPGQWCFKGH
CIWKSLEQTYGQDGGWSSWTKFGSCSRSCGGGVRSRSRSCNNPPPAYGGRLCPGPEFQYQ
ICNSEECPGPYEDFRAQQCAKRNSYYIHQNAKHSWLPYEPEDDAQKCELICRSEDTGDVV
FMNQVVHDGTRCSYRDPYSVCARGECVPVGCDKEVGSMKADDKCGVCGGDNSHCRTVKGT
LGKASKQAGALKLVQIPAGARHIQIEELEKVPHHIAVKNQVTGSFILNPKGKEAMSRTFT
AMGLEWEYVVEDTKESLKTSGPLPEAIAVLVLPPAKGGPRSSLAYKYVIHEDLLPLIGSN
NVLLEETDTYEWALKSWAPCTKSCGGGIQFTKYGCRRRRDHHMVQRHLCDHRKRPKPIRR
RCNQHPCAQPTWVTEEWGACSRSCGKLGVQTRGVQCLLPLSNSTHKAMPVKACPGDRPEA
RRPCFRVPCPAQWRMGAWSQCSATCGEGIQQRQVVCRTNANSLGQCEGDKPDTVQVCSLP
ACAGNLQNSTVSTDIQEPVTPEEEWVPQSGPLYPINKISSTEPCTGDRSIFCRMEVLDRY
CSIPGYYRLCCESCTKRALDPDASLDPRLTSPPPFSTPGSPLPGSKAPPDAVEPTVGPTG
ADDHQHGQPTQLPRPLGTSSPVTQHHSPPQNLSPRVSWGTSPSAPRGLPWGWTRAPVPIS
EDKGQLREAPKPPGT
Download sequence
Identical sequences M3XYT8
ENSMPUP00000004239 ENSMPUP00000004239 XP_004769568.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]