SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004281 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004281
Domain Number 1 Region: 2617-2907
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.59e-71
Family Protein kinases, catalytic subunit 0.00000108
Further Details:      
 
Domain Number 2 Region: 1256-1435
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.15e-52
Family DBL homology domain (DH-domain) 0.0000000148
Further Details:      
 
Domain Number 3 Region: 1864-2057
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.9e-51
Family DBL homology domain (DH-domain) 0.0000212
Further Details:      
 
Domain Number 4 Region: 1442-1562
Classification Level Classification E-value
Superfamily PH domain-like 6.97e-34
Family Pleckstrin-homology domain (PH domain) 0.00000213
Further Details:      
 
Domain Number 5 Region: 2058-2175
Classification Level Classification E-value
Superfamily PH domain-like 3.64e-31
Family Pleckstrin-homology domain (PH domain) 0.00055
Further Details:      
 
Domain Number 6 Region: 2496-2608
Classification Level Classification E-value
Superfamily Fibronectin type III 2.61e-25
Family Fibronectin type III 0.00077
Further Details:      
 
Domain Number 7 Region: 2415-2519
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-24
Family I set domains 0.0066
Further Details:      
 
Domain Number 8 Region: 263-399
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-19
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 9 Region: 1074-1211
Classification Level Classification E-value
Superfamily Spectrin repeat 1.06e-17
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number 10 Region: 827-977
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-17
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 11 Region: 485-626
Classification Level Classification E-value
Superfamily Spectrin repeat 1.85e-17
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 12 Region: 2265-2328
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000249
Family SH3-domain 0.000034
Further Details:      
 
Domain Number 13 Region: 1621-1686
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000574
Family SH3-domain 0.0035
Further Details:      
 
Domain Number 14 Region: 20-166
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000196
Family CRAL/TRIO domain 0.015
Further Details:      
 
Domain Number 15 Region: 176-294
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000183
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 16 Region: 631-751
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000101
Family Spectrin repeat 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004281   Gene: ENSMPUG00000004314   Transcript: ENSMPUT00000004357
Sequence length 2930
Comment pep:known scaffold:MusPutFur1.0:GL896912.1:16189668:16716319:-1 gene:ENSMPUG00000004314 transcript:ENSMPUT00000004357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHHIASIWSFRNDGLKASDVLPILKEKVAFVSGGRDKRGGPILTFPARSNHDRIRQEDLR
KLVTYLASVPSEDVCKRGFTVIIDMRGSKWDLIKPLLKTLQEAFPAEIHVALIIKPDNFW
QKQKTNFGSSKFIFETSMVSVEGLTKLVDPSQLTEEFDGSLDYNHEEWIELRLSLEEFFN
SAVHLLSRLEDLQEMLARKEFPVDVEGSRRLIDEHTQLKKKVLKAPVEELDREGQRLLQC
IRCSDGFSGRNCIPGSADFQSLVPKITSLLDKLHSTRQHLHQMWHVRKLKLDQCFQLRLF
EQDAEKMFDWISHNKELFLQSHTEIGVSYQHALDLQTQHNHFAMNSMNAYVNINRIMSVA
SRLSEAGHYASQQIKQISTQLDQEWKSFAAALDERSTILAMSAVFHQKAEQFLSGVDAWC
KMCSEGGLPSEMQDLELAIHHHQSLYEQVTQAYTEVSQDGKALLDVLQRPLSPGNSESLT
ATANYSKAVHQVLDVVHEVLHHQRRLESIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENH
GEAFLSKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEI
YKAARHLEVRIQDFVRRVEQRKLLLDMSVSFHTHTKELWTWMEDLQKEMLEDVCADSVDA
VQELIKQFQQQQTATLDATLNVIKEGEDLIQQLRSAPPSLGEPSEARDSAVSNNKTPHGS
SISHVESVLQQLDDAQVQMEELFHERRIKLDIFLQLRIFEQYTIEVTAELDAWNEDLLRQ
MNDFNTEDLTLAEQRLQRHTERKLAMNNMTFEVIQQGQDLHQYIMEVQASGIELICEKDI
DLAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQAEVKQVLGWIRNGESMLNA
SLVNASSLSEAEQLQREHEQFQLAIEKTHQSALQVQQKAEALLQAGHYDADAIRECAEKV
ALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYRRDEDWCGGRDKLGPAAE
IDHVIPLISKHLEQKEAFLKACTLARRNAEVFLKYIHRNNVSMPSAASHTRGPEQQVKAI
LSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAKQALDWIQETGEYYLSTHTSTGDTT
EETQELLKEYGEFRVPAKQTKEKVKLLIQLADSFVEKGHIHATEIRKWVTTVDKHYRDFS
LRMGKYRYSLEKALGVNTEDNKDLELDIIPASLSDREVKLRDANHEVNEEKRKSARKKEF
IMAELLQTEKAYVRDLHECLETYLWEMTSGVEEIPAGILNKEHVIFGNIQEIYDFHNNIF
LKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSNQLILEHAGTFFDEIQQRHGLA
NSISSYLIKPVQRITKYQLLLKELLTCCEEGKGELKDGLEVMLSVPKKANDAMHVSMLEG
FDENLDVQGELILQDAFQVWDPKSLIRKGRERHLFLFEISLVFSKEIKDSSGHTKYVYKN
KLLTSELGVTEHVEGDPCKFALWSGRTPSSDNKTVLKASNIETKQEWIKNIREVIQERII
HLKGALKEPIQLPKTPAKQRNNSKRDGVEDVDSQGDGSSQPDTISIASRTSQNTVDSDKL
SGGCELTVVLQDFNAGHSSELTIQVGQTVELLERPSERPGWCLVRTTERSPPQEGLVPSS
ALCISHSRSSVEMDCFFPLVKDAYSHSSSENGGKSDSVANLQSQPSLNSIHSSPGPKRST
NTLKKWLTSPVRRLNSGKADGNIKKQKKVRDGRKSFDLGSPKPGDETTPQGDSADENKKG
WGEDEPDEESHTPLPPPMKIFDNDPTQDEMSLEGGSYRGSLKDPVGCLNEGMTPPTPPRN
LEEEQKAKALRGRMFVLNELVQTEKDYVKDLGIVVEGFMKRIEEKGVPEDMRGKDKIVFG
NIHQIYDWHKDFFLAELEKCIQEQDRLAQLFIKHERKLHIYVWYCQNKPRSEYIVAEYDT
YFEEVKQEINQRLTLSDFLIKPIQRITKYQLLLKDFLRYSEKAGLECSDIEKAVELMCLV
PKRCNDMMNLGRLQGFEGTLTAQGKLLQQDTFYVIELDTGMQSRTKERRVFLFEQIVIFS
ELLRKGSLTPGYMFKRSIKMNYLVLEENVDNDPCKFALMNRETSERVILQAANADIQQAW
VQDINQVLETQRDFLNALQSPIEYQRKERSTAVMRSQPSRVPQASPRPYSSVPTGSEKPP
KGSSYNPPLPPLKISTSNGSPGFDYHQPGDKFEASKQGDLGGCNGTSSMAVIKDYYALKE
NEICVSQGEVVQVLAVNQQSMCLVYQPASDHSPAAEGWVPGSVLAPLPKATAATENSDGS
IKKSCSWHTLRMRKRAEVEHTGKNEATGPRKPKDILGNKVSVKETNSSEESECDDLDPNT
SMEILNPNFIQEVAPEFLVPLVDVTCLLGDTVTLQCKVCGRPKPTITWKGPDQNILDTDN
SSATYTVSSCDSGEITLKICNLMPQDSGIYTCIATNDHGTTSTSATVKVQGVPAAPNRPI
AQERSCTSVILRWLPPSSTGNCTISGYTVEYREEGSQAWQQSVASTLDTYLVIEDLSPGS
PYQFRVSASNPWGISLPSEPSEFVRLPEYDAAADGATISWKENFDSAYTELNEIGRGRFS
IVKKCIHKATRKDVAVKFVSKKMKKKEQAAHEAALLQHLQHPQYITLHDTYESPTSYILI
LELMDDGRLLDYLMNHDELMEEKVAFYIRDIMEALQYLHNCRVAHLDIKPENLLIDLRIP
VPRVKLIDLEDAVQISGHFHIHHLLGNPEFAAPEVIQGIPVSLGTDIWSIGVLTYVMLSG
VSPFLDESKEETCINVCRVDFSFPHEYFCGVSNAARDFINVILQEDFRRRPTAATCLQHP
WLQPHNGSYSKIPLDTSRLACFIERRKHQNDVRPVPNVKSYIVNRVNQGT
Download sequence
Identical sequences M3XYY0
ENSMPUP00000004281 ENSMPUP00000004281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]