SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004419 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004419
Domain Number 1 Region: 174-314
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 3.92e-17
Family CRAL/TRIO domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004419   Gene: ENSMPUG00000004453   Transcript: ENSMPUT00000004496
Sequence length 371
Comment pep:novel scaffold:MusPutFur1.0:GL897062.1:706727:729184:1 gene:ENSMPUG00000004453 transcript:ENSMPUT00000004496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTTEATLRMENVDVKEEWQDEGLPRPLPEETGMDPLGSPTEDTSPPPNTLNFNGAHRKR
KTLVAPEINISLDQSEGSLLSDDFLDTPDDLDINVDDIETPDETDSLEFLGNGNELEWED
DTPVAAAKNMPGDSADLFGDGAAEDGSAANGRLWRTVIIGEQEHRIDLHMIRPYMRVVTH
GGYYGEGLNAIIVFAACFLPDSSSPDYHYIMENLFLYVISSLELLVAEDYMIVYLNGATP
RRRMPGIGWLKKCYQMIDRRLRKNLKSLIIVHPSWFIRTVLAISRPFISVKFINKIQYVH
SLEDLEQLIPMEHVQIPECVLQYEEERLKARRESARPPPEFVLPRAEEKPEAASAEDRSA
PGTEDQETSLS
Download sequence
Identical sequences M3XZB8
XP_004771466.1.14098 XP_004771467.1.14098 ENSMPUP00000004419 ENSMPUP00000004419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]