SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004445 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000004445
Domain Number - Region: 41-95
Classification Level Classification E-value
Superfamily DEATH domain 0.00177
Family Caspase recruitment domain, CARD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004445   Gene: ENSMPUG00000004480   Transcript: ENSMPUT00000004523
Sequence length 163
Comment pep:novel scaffold:MusPutFur1.0:GL897017.1:851674:866673:-1 gene:ENSMPUG00000004480 transcript:ENSMPUT00000004523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEQTYCDRLVQDTPFLMGHGRLSEQQVDRIILQLNRYYPQILSNKDAEKFRNPKASLRV
RLCDLLGHLQRSGERDCQEFYRALYIHAQPLHSRLPSRLALRPVAFLACLGLAAGLALLV
YCCPPDPKVLPGARRVLGFSPVIVDRHVSRFLLAFLTDDLGGL
Download sequence
Identical sequences M3XZE4
ENSMPUP00000004445 ENSMPUP00000004445 XP_012918839.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]