SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004466 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004466
Domain Number 1 Region: 106-171
Classification Level Classification E-value
Superfamily Chromo domain-like 7.51e-19
Family Chromo domain 0.0000608
Further Details:      
 
Domain Number 2 Region: 24-69
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000241
Family Chromo domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004466   Gene: ENSMPUG00000004502   Transcript: ENSMPUT00000004545
Sequence length 177
Comment pep:novel scaffold:MusPutFur1.0:GL897158.1:166524:167073:-1 gene:ENSMPUG00000004502 transcript:ENSMPUT00000004545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FKSNKTTFPKKKGGGRNRIGKSKKVEEADPEKVVEKHVVSGKVEYFLRKKGFDADSTREP
EEFFHCPELKDFLILKKLLKKNRVQKENLYLTVNQMTANQRRDTADKPRGLARGPDPEGK
IGATDSSGKLMFLMKWKDSDEADLVLAKESIMKCAQIIIAFYEERLTWHSCPEDEAQ
Download sequence
Identical sequences M3XZG5
ENSMPUP00000004466 ENSMPUP00000004466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]