SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004476 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004476
Domain Number 1 Region: 10-115
Classification Level Classification E-value
Superfamily CAD & PB1 domains 5.1e-38
Family CAD domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004476   Gene: ENSMPUG00000004512   Transcript: ENSMPUT00000004555
Sequence length 219
Comment pep:novel scaffold:MusPutFur1.0:GL896906.1:5473392:5497550:-1 gene:ENSMPUG00000004512 transcript:ENSMPUT00000004555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METARDYAGALIRPLRFMGSQTKRVLLTPLMHSARPFRVSNHDRSSRRGVMATSLKDLLS
KTLEALVITSGLVSLVLEEDGTVVDTEEFFQTLEDNTHFMILEKGQKWTPGGNYVSARQQ
PKKAGIARVTFDLYKLNPKDVIGCLNVKATMYEMYSVSYDIRCTGVKALLRSLLRLVSHA
AQVTGQLLIYTGSYMLQLLGDTEGPAPRRSHSRRGFTCG
Download sequence
Identical sequences M3XZH5
ENSMPUP00000004476 ENSMPUP00000004476 XP_004742743.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]