SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004555 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004555
Domain Number 1 Region: 53-501
Classification Level Classification E-value
Superfamily Sema domain 5.1e-143
Family Sema domain 0.0000000775
Further Details:      
 
Domain Number 2 Region: 794-846
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000366
Family TSP-1 type 1 repeat 0.00047
Further Details:      
 
Domain Number 3 Region: 606-656
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000916
Family TSP-1 type 1 repeat 0.00035
Further Details:      
 
Domain Number 4 Region: 849-906
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000183
Family TSP-1 type 1 repeat 0.00048
Further Details:      
 
Domain Number 5 Region: 497-546
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000061
Family Plexin repeat 0.0049
Further Details:      
 
Domain Number 6 Region: 660-712
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000549
Family TSP-1 type 1 repeat 0.0008
Further Details:      
 
Domain Number 7 Region: 907-951
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000196
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000004555
Domain Number - Region: 551-603
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000262
Family TSP-1 type 1 repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004555   Gene: ENSMPUG00000004590   Transcript: ENSMPUT00000004634
Sequence length 1093
Comment pep:novel scaffold:MusPutFur1.0:GL896912.1:17859848:17977322:1 gene:ENSMPUG00000004590 transcript:ENSMPUT00000004634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFPGPLAITLLPPSLTLLVFHLSSSQDVAPEPSSEPQLCSLREHPTVAFADLKPWVFNF
TYPGARDFSQLALDPSRNQLIVGARNYLFRLSLANVSLLQATEWASNEDTRRSCQSKGKT
EEECQNYLRVLIVTGRKVFMCGTNAFSPVCSSRQVGNLSRTIEKINGVARCPYDPRHNST
AVISSQGELYAATVIDFSGRDPAIYRSLGSRPPLRTAQYNSKWLNEPNFVAAYDIGLFAY
FFLRENAVEHDCGRTVYSRVARVCKNDVGGRFLLEDTWTTFMKARLNCSRPGEVPFYYNE
LQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFRYQENPRAAWLPIAN
PIPNFQCGTLPEVGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDL
VQAKDTLYHVLYIGTESGTILKALSTASRSLRGCYLEELHVLPPGRREPLRSLRILHSAR
ALFVGLSDGVLRVPLERCATYRSQGACLGARDPYCGWDGKQQRCSTLEDSSNMSLWTQNI
TACPVRNVTRDGGFGQWSPWQPCEHLDGDNSGSCLCRARACDSPRPRCGGRDCLGPAIHI
ANCSRNGAWTPWSSWALCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTP
CPVPIFWASWGSWNKCSSNCGGGVQSRRRSCENGNSCPGCGVEFKTCNPEGCPEVRRNTP
WTPWLPVNVTQGGARQEQRFRFTCRAPLPDPHGLQFGRRRTETRTCPADGSGACDTDALV
EDLLRSGGTSPHSVSGGWAAWGPWSSCSRDCELGFRVRKRTCTNPEPRNGGLPCVGDAAE
YQDCNPQACPVRGAWSCWTSWSPCSASCGGGHYQRTRSCTSPAPSPGEDICLGLHTEEAL
CATQACPEGWSPWSEWSACTEDGAQSRSRHCEELVPGPSTCAGNSSQSRPCPYSEIPVIL
PASSTEESAGCGGFSLIHLVATGVSCFLGSGLLTLAVYLSCQHCQRQSQESTLVHPATPN
HLHYKGGGTPKNEKYTPMEFKTLNKNNLIPDDRANFYPLQQTNVYTTTYYPSPLNKHSFR
PEASPGQRCFPNS
Download sequence
Identical sequences M3XZQ4
ENSMPUP00000004555 ENSMPUP00000004555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]