SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004635 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000004635
Domain Number - Region: 14-74
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0186
Family IMD domain 0.058
Further Details:      
 
Domain Number - Region: 100-148
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0458
Family Mitotic arrest deficient-like 1, Mad1 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004635   Gene: ENSMPUG00000004672   Transcript: ENSMPUT00000004716
Sequence length 162
Comment pep:novel scaffold:MusPutFur1.0:GL897177.1:815773:818929:-1 gene:ENSMPUG00000004672 transcript:ENSMPUT00000004716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLCRLFVLPASYQRFSDCYKRLCQLQPDVTQRIHDKFVAQLQASVREEISEIKAEGNLEA
VLDALDRIVEEGKDRTEPAWRPSGIPEADVRSVAVPYFLQQRDALQRRVRRQEAENRRLA
EAVLAGRRQLEQLEQQAQARQQAWQALHREQKELLGVLGEPE
Download sequence
Identical sequences M3XZY4
ENSMPUP00000004635 ENSMPUP00000004635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]