SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004654 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004654
Domain Number 1 Region: 76-111
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000889
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 1002-1053
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 3 Region: 810-868
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000051
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 4 Region: 752-810
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000115
Family TSP-1 type 1 repeat 0.0064
Further Details:      
 
Domain Number 5 Region: 940-998
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 6 Region: 872-936
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000981
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 7 Region: 695-750
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000798
Family TSP-1 type 1 repeat 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004654   Gene: ENSMPUG00000004691   Transcript: ENSMPUT00000004735
Sequence length 1102
Comment pep:novel scaffold:MusPutFur1.0:GL897134.1:1582083:1592971:-1 gene:ENSMPUG00000004691 transcript:ENSMPUT00000004735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHRARPLQPRCLSSVFTSGPLSQARGIEGGAMEKWAGRPQLCLMLLLSFPELGLDQEVL
SGHSLQTLPEEGQGPEGVWGPWEQWASCSQPCGVGVQRRSRTCQLPTAQLHQDLPFPPRP
PRHPEALLPRGQSPRPQTSRGTLPLYRPQPRGRGGPRRGPTSQLGRAEIREIPGARRSRV
RDPIKPGMFGYGRVPFALPLHRNRRHPQRLPRAETSQTSDLPSLTPRTEPFSTNHTAQTQ
LAPTELSARPPHPPAEPPSPETTQTEVPSRTRPFPTQPHPRAQASGTEPASSIPYPGESN
SFHVSPQPRMPESQGSASFQVAERYPNLFLSVPRGRGHQSQEHWKPGGNLHGSLMEPAPH
YPDGWLPLLNDGPHSSSLWSLFAPNSPVPRCSGESEQLRACSQAPCPPEQPDPRAQQCAA
FDSQEFMGQLYQWEPFTEVQGSQRCELNCRPRGFRFYVRHTEKVQDGTLCQPGALDICVA
GRCLSPGCDGILGSGRRPDGCGVCGGDDSTCHLVSGNLTDRGGPLGYQKILSIPAGATQL
QIAQLRPSSNYLALRGPGGQSIINGNWAVDPPGSYTASGTVFLYNRPSREEGKGESLSAK
GPTTQPVDVYVIFQEENPGIFYQYIISSVLPDLGSTTPEPHFPQLQPEILRVEPPPASMP
RPARTPGTLQRQVRIPQMHAPPHPRTPLGSPAGYWKQVGHSECSASCGKGVWRPIFLCIS
RESGEELDEHSCAMGARPPVPLEPCHGPPCPPYWEAGEWTSCSSSCGSGTQHRQLRCRQE
FGGGGSSVPPERCGHLPRPNATQPCQLRLCGHWEVRSPWSQCSVRCGRGQRSRQVRCVGS
NGDEVNERECASGPPRPPSREACDMGPCTTAWFHSDWNSKCSAECGTGIQRRSVVCLGSG
ESRGAGQEEAGAGSTEQSCAPGSRPPDMRACSLGPCEMTWCWYTGPWAECSSECGSGTQR
RDIICVSKLGMEFNVTSPSNCSHLPRPPALQPCQGQDCSDRWFSTPWSPCSRSCQGGIQT
REVQCLTANQTLSVRCPPHLRPSRKRPCNSQPCSQRPDDQCKDSSPHCPLVVQARLCVYP
YYTATCCRSCAHVLERSPPEPA
Download sequence
Identical sequences M3Y003
XP_004776853.1.14098 ENSMPUP00000004654 ENSMPUP00000004654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]