SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004726 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004726
Domain Number 1 Region: 294-390
Classification Level Classification E-value
Superfamily PDZ domain-like 8.52e-20
Family PDZ domain 0.00001
Further Details:      
 
Domain Number 2 Region: 1445-1511
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.24e-19
Family SAM (sterile alpha motif) domain 0.00028
Further Details:      
 
Domain Number 3 Region: 189-262
Classification Level Classification E-value
Superfamily SH3-domain 1.31e-16
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004726   Gene: ENSMPUG00000004764   Transcript: ENSMPUT00000004808
Sequence length 1513
Comment pep:known scaffold:MusPutFur1.0:GL896969.1:6898935:7161875:-1 gene:ENSMPUG00000004764 transcript:ENSMPUT00000004808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSYARKHAVPRRPPPLPGSEPLQRRGAGQPSSPSSHPRRLYNERTAAKVGGKMKSLLNA
FTKKEVPFREAPAYSNRRRRPPNTLAAPRVLLRSNSDNNLNASTPDWAVCSATSHRSLSP
QLLQQTPGKPEGAARTLGSYAPGPRSRSPSLNRLGGAGEDGKRPQPSWHVGPAFLPGASK
DALSAFEYPEPKRKLYSAVPGRLFVVVKPYLPQVDGEIPLHRGDRVKVLSIGEGGFWEGS
ARGHIGWFPAECVEEVMCRPKDSQAETRADRSKKLFRHYTVGSYDSFDATSDCVIEEKTV
VLQKKDNEGFGFVLRGAKADTPIEEFTPTPAFPALQYLESVDEGGVAWQAGLRTGDFLIE
VNNENVVKVGHRQVVNMIRQGGNHLVLKVVTVTRNLDPDDTARKKAPPPPKRAPTTALTL
RSKSMTSELEELDKPEEIVPASKPSRAADNVAMESRVATIKQRPTSRCFPSVSDMNSVYE
RQGIAVMTPTVPGSPKGPFLGLPRGTMRRQKSIDSRIFLSGITEEERQFLAPPMLKFTRS
LSMPDTSEDIPPPPQSVPPSPPPPSPTTYNCPKSPTPRVYGTIKPAFNQNPAAKVSPAAR
SDTVATVMRDKGLYYRRELDRYSLDSDDLYSCSAAAQANFRAKRGQMPENPYSEVGRIAS
KAVYVPAKPARRKGMLVKQSNVEDSPEKTCSIPIPTIIVKEPSTSSSGKSSQGSSTEIDP
QAPEPPGQLRPDDSLTVSSPFAAAIAGAVRDREKRLEARRNSPAFLSTDLGDEDVGLGPP
AARAHPSNFPEEVGFSEEDGAEPLSLPTPVALPREPENHFVGGGEAAAQGEAGRPLNSTS
KAKGPEGSPAVPPKSSSAASPENYVHPLTGRLLDPSSPLALALSARDRAMKESQQGPKGE
APKADLHKPLYIDTKMRPSVEAGFPPVTRQNTRGPLRRQETENKFEAELGKDRKGEDKKH
TLINIVDTSQQRSAGLLMVHTVDAATTDHLLREEDEKADVEATPDHSLPEGPEGAPETEG
ALQISASPEPAAAVPGRTIVAAGSVEEAVILPFRIPPPPLASVDLDEDFIFTEPLPPPLE
FANSFDIPDDRIASVPALTDLVKQKKQDASPSPSLNPSQPANCADSKKPAGLSNCLPASF
LPPPENFDVVTDSGIEEVDSRSSSDHHLETTSTISTVSSMSTLSSEGGENVDTCTVYADG
QAFTVDKPPVPPKPKVKPIIPKSNALYQDALVEEDVDSFVIPPPAPPPPPGSAQPGATKV
TPPRTSKLWGDVSEVRSPIRSGPKANVISELNSILQQMNREKSAKPGEGLDSPTGTKPAS
LAPRSPEVMSTVSGTRSTTVTFTVRPGTSQPITLQSRPTDFESRTSGTRRAPSPVVSPTE
LSKEILPAPLSAAAATPSPTLSEVFSLPSQPPSGDLFGLNPAGRSRSPSPSILQQPISNK
PFTTKPVHLWTKPDVADWLESLNLGEHKETFMDNEIDGSHLPNLQKEDLIDLGVTRVGHR
MNIERALKQLLDR
Download sequence
Identical sequences M3Y075
ENSMPUP00000004726 ENSMPUP00000004726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]