SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004846 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004846
Domain Number 1 Region: 416-473
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-22
Family SH3-domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004846   Gene: ENSMPUG00000004886   Transcript: ENSMPUT00000004930
Sequence length 474
Comment pep:known scaffold:MusPutFur1.0:GL896912.1:19061562:19084273:1 gene:ENSMPUG00000004886 transcript:ENSMPUT00000004930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWKSVVGHDVSVSVETQGDDWDTDPDFVNDISEKEQRWGAKTIEGSGRTEHINIHQLRNK
VSEEHDSLKKKEMESGPKASHGYGGRFGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGF
GGKYGVEKDRADKSAVGFDYKGEVEKHASQKDYSHGFGGRYGIEKDKKDKAAVGYDYKGE
TEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGARGLKA
KFESMAEEKRKREEEEKAQQIARQQQERKALIKMSHEAKQPVDTVGEPEVPAPVPKKISS
EAWPPAGSCPSSEPEPVRTSKEHPVPAPPLRQNPPEEEEPPALPPRTLEGLQLEEEPVYE
AEPEPEPENDYEDVGEMDRQEQDGEPDGDYEDVLEIENPSCPSTLAESSSHPAGTGAGIS
AIALYDYQGEGSDEISFDPDDIITDIEMVDEGWWRGRCHGHFGLFPANYVKLLQ
Download sequence
Identical sequences M3Y0J5
XP_004745552.1.14098 ENSMPUP00000004846 ENSMPUP00000004846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]