SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004852 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004852
Domain Number 1 Region: 23-304
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.32e-70
Family FCH domain 0.0055
Further Details:      
 
Domain Number 2 Region: 437-497
Classification Level Classification E-value
Superfamily SH3-domain 5.64e-18
Family SH3-domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004852   Gene: ENSMPUG00000004892   Transcript: ENSMPUT00000004936
Sequence length 499
Comment pep:novel scaffold:MusPutFur1.0:GL896991.1:1018502:1022490:1 gene:ENSMPUG00000004892 transcript:ENSMPUT00000004936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NAMAPEEDAGGEALEGSFWEAGNYRRTVQRVEDGHRLCGDLVSCFQERARIEKVYAQQLA
DWARKWRGTVEKGPQYGTLEKAWHAFFTAAERLSALHLEVREKLQGQDSERVRAWQRGAF
HRPVLGGFRESRAAEDGFRKAQKPWLKRLKEVEASKKSYHAARKEEKTAQTRESHAKADS
AVSQEQLRKLQERVERCAREAEKMKSHYEQTLAELHRYTPRYMEDMEQAFESCQAAERQR
LLFFKDMLLTLHQHLDLSSSERFHELHRDLHQGIEAVSDEEDLHWWRSTHGPGMAMNWPQ
FEEWSLDTQRTISRKEKGGRSPDEVTLTSIVPTRDGAAPPPQSPGSPGLHLNWVANWCQE
PQALCSCPPWVAGSVPGSRVQMAEVRPGSLSSFPPAFPRVLPEGDPLSWVVDSLTNSPLC
SGGQDEEWSDEENTRKAATGVRVRALYDYAGQEADELSFRAGEELLKMSEEDEQGWCQGQ
LQSGRIGLYPANYVECVGA
Download sequence
Identical sequences M3Y0K1
ENSMPUP00000004852 ENSMPUP00000004852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]