SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004934 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004934
Domain Number 1 Region: 570-615
Classification Level Classification E-value
Superfamily F-box domain 0.00000183
Family F-box domain 0.011
Further Details:      
 
Domain Number 2 Region: 34-97
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000203
Family SIAH, seven in absentia homolog 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004934   Gene: ENSMPUG00000004973   Transcript: ENSMPUT00000005018
Sequence length 744
Comment pep:novel scaffold:MusPutFur1.0:GL896912.1:19086152:19111335:-1 gene:ENSMPUG00000004973 transcript:ENSMPUT00000005018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRARRPLTGQHRHCEKCFNRHCHIPVEPDVSCLVINCHLSCGATFHMCKEAEHELLCPL
EEVPCLNSEYGCPLSMSRHKLAKHLQVCPASVVCCSMEWNRWPNVDSETILHENIMKETP
SEECLDTALALQDQKVLFRSLKMVELFPETREPTEEEPTMNGEASWEEMGGAVGGAEASL
VPHGGLSATNGEMVELSQEEREVLAKTKEGMDLAKFDKWENIFSKEHAASALTSSSVGCE
SKNGHNPGKEQFSSDNNMGGEETFKEKEPQEKQKQQDFHAALETTGLAPWQDGVLERLKT
AVDAKDYNMYLVHNGRMLIHFGQMPACTPKERDFVYGNLEAQEVKTVYTFKVPVSYCGKR
ARVGDAMSSCKPSEHKAVDTSDLGITVEDLPKSDLIKTTLLCALERELKGHVISESRSID
GLFMDFATQTYNFEPEQFSSGTVLADLLTNANPGGLHVELHSECVTRRHNKSSSAFTFTC
NKFFRRDEFPLHFKNVHTDIQSCLNGWFQHRCPLAYLGCTFIQNHFRPPGQKAKVIYSQE
LKTFAIKPEVASELSERKKNNHLSGHGGKSQNCLTSLPLEVLQYIAGFLDSISLSQLSQV
SVLMRNICATLLQERGMVLLQWKKKRYSHGGTSWRVHREIWQFSSLFSKIKSWEFNEVAS
MAEHLKACPFNVVEHKTDPILLTSMCQLQEQARESLVTTFRDRPRGNQDTTSVDGSTQTS
TFYGEKAVGAKRKPLRETVDQTEK
Download sequence
Identical sequences M3Y0T3
ENSMPUP00000004934 ENSMPUP00000004934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]