SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005149 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005149
Domain Number 1 Region: 147-242
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 2 Region: 36-100
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000125
Family Eukaryotic type KH-domain (KH-domain type I) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005149   Gene: ENSMPUG00000005186   Transcript: ENSMPUT00000005236
Sequence length 529
Comment pep:known scaffold:MusPutFur1.0:GL897177.1:1034734:1048299:1 gene:ENSMPUG00000005186 transcript:ENSMPUT00000005236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQAAGKGLTSSKSKDDLVVAEVEINDVPLTCRNLLTRGQTQDEISRLSGAAVSTRGRFMT
AEEKAKVGPGDRPLYLHVQGQTRELVDRAVNRIKEIITNGVVKAATGTSPTFNGATVTVY
HQPAPIAQLSPAVSQKPPFQSGMHYVQDKLFVGLEHAVPTFNVKEKVEGPGCSYLQHIQI
ETGAKVFLRGKGSGCIEPASGREAFEPMYIYISHPKPEGLAAAKKLCENLLQTVHAEYSR
FVNQINTAVPLPGYTQPSALSSVPPQPPYYPSNGYQSGYPVVPPPQQPVQPPYGVPSIVP
PAVSLAPGVLPALPTGVPPVPTQYPITQVQPPAGAGQSPMSGPFIPAAPVKTALPAGPQP
PPPPPPPLPAQPQAQKRRFTEELPDERESGLLGYQHGPIHMTNLGTGFSSQNEIEGAGSK
PASSSGKERERDRQLMPPPAFPVTGMKAESEDRNGSGAGAGGHDYPVKKMKTAEKGFGLV
AYAADSSDEEEEHGGHKNASSFPQGWSLGYQYPSSQPRAKQQMPFWMAP
Download sequence
Identical sequences M3Y1E8
ENSMPUP00000005149 ENSMPUP00000005149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]