SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005192 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005192
Domain Number 1 Region: 619-786
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.49e-44
Family SPRY domain 0.004
Further Details:      
 
Domain Number 2 Region: 439-534
Classification Level Classification E-value
Superfamily Fibronectin type III 3.88e-17
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 3 Region: 221-284
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000229
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Domain Number 4 Region: 2-51
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000707
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000005192
Domain Number - Region: 164-198
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0555
Family TFIIH p44 subunit cysteine-rich domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005192   Gene: ENSMPUG00000005230   Transcript: ENSMPUT00000005280
Sequence length 795
Comment pep:novel scaffold:MusPutFur1.0:GL896900.1:5681073:5788963:-1 gene:ENSMPUG00000005230 transcript:ENSMPUT00000005280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSRRASGSGVSDY
DYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPV
PRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATV
MCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMY
CVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRN
MVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKL
RQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMTTDFDLSLDNS
PLLQSIHQLDFVQMKASSPVPATPILQLEECCTHNNSATLSWKQPPLSTVPAEGYILELD
DGNGGQFREVYVGKETMCTVDGLHFNSTYNARIKAFNKTGVSQYSKTLVLQTSEDTDSEE
QTLPFPVPSERLPLRRMSPFSSTLNLQPSFPGRSYFDIRSSPHQLSLHSSLQSLNAPGCN
FEPQSAPYSQLVDIKKLLAVAWFAFDPGSAHADIIFSNDNLTVTCSSYDDRVVLGKTGFS
KGVHYWELTVDRYDNHPDPAFGVARMDVMKDVMLGKDDKAWAMYVDNHRSWFMHNNSHTN
RTEGGITKGATIGVLLDLNRKTLTFFINDEQQGPIAFENVEGLFFPAVSLNRNVQVTLHT
GLPVPDFYSSRASIA
Download sequence
Identical sequences M3Y1J1
ENSMPUP00000005192 XP_012911571.1.14098 ENSMPUP00000005192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]