SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005234 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005234
Domain Number 1 Region: 258-478
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.71e-54
Family DBL homology domain (DH-domain) 0.0000809
Further Details:      
 
Domain Number 2 Region: 469-606
Classification Level Classification E-value
Superfamily PH domain-like 7.5e-19
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 
Domain Number 3 Region: 604-678
Classification Level Classification E-value
Superfamily SH3-domain 8.93e-17
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005234   Gene: ENSMPUG00000005272   Transcript: ENSMPUT00000005322
Sequence length 714
Comment pep:known scaffold:MusPutFur1.0:GL897080.1:3561850:3664947:-1 gene:ENSMPUG00000005272 transcript:ENSMPUT00000005322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METRGSEGSEKPWKELVSGSQETDDGWDKGRPELLSEDEKTCHANQGTRDREPGRYLPIQ
RNSTFNRTVKHKSKGQARDAPEQNTPHQADSLENGQSVNEPLTLNFPQSRMSWWKIPIQP
HPGAKRTSESSSTPGNGATPEECPALADSPTTLTEALQTIHPIPADSWRNLIEQIGLLYQ
EYRDKSTLQEIETRRQLDAEIHTNAHGSPASEETPEEEEEEEEEEEEEDEPASPPERKAL
PQICLLSNPHSRFNLWQDLPEIQSSGVLEILQPEEIKLQEAMFELVTSEASYYKSLSLLV
SHFMENERLKKILHPSEAHILFSNVLDVMAVSERFLLELERRMEENIVISDVCDIVYHYA
ANHFSVYITYVSNQTYQERTYKQLLQEKAAFRELIAQLELDPKCRGLPLSSFLILPFQRI
TRLKLLVQNILKRVEERSERECTALDAHKELEMVVKACNEGVRKMSRTEQMISIQKKMEF
KIKSVPIISHSRWLLKQGELQQMSGPKTSRTLRTKKLFREIYLFLFNDLLVICRQIPGDK
YQVFDSAPRGLLRVEELEDQGQTLANVFILRLLENADDREATYMLKATSQSEMKRWMTSL
APNRRTKFVSFTSRLLDCPQVQCVHPYVAQQPDELTLELADILNILEKTEDGWIFGERLH
DQERGWFPSSMTEEILNPKIRSQNLKECFRVHKMDDPQRSQNKDRRKLGSRNRQ
Download sequence
Identical sequences M3Y1N3
ENSMPUP00000005234 ENSMPUP00000005234 XP_004773558.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]