SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005246 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005246
Domain Number 1 Region: 380-508
Classification Level Classification E-value
Superfamily Cadherin-like 5.42e-18
Family Cadherin 0.0012
Further Details:      
 
Domain Number 2 Region: 497-610
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000785
Family Cadherin 0.0019
Further Details:      
 
Domain Number 3 Region: 175-288
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000011
Family Cadherin 0.0005
Further Details:      
 
Domain Number 4 Region: 76-173
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000514
Family Cadherin 0.0023
Further Details:      
 
Domain Number 5 Region: 299-391
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000428
Family Cadherin 0.0034
Further Details:      
 
Domain Number 6 Region: 615-709
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000585
Family Cadherin 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005246   Gene: ENSMPUG00000005284   Transcript: ENSMPUT00000005334
Sequence length 883
Comment pep:novel scaffold:MusPutFur1.0:GL896910.1:17963826:17974140:-1 gene:ENSMPUG00000005284 transcript:ENSMPUT00000005334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPPTCSSVRPALPHPSRPGQHSLEKEPSHLAAGPREPALGTGGCPGVEGPILTMVPAW
LLLLCLSIAQVFPEDQYAELKVEVPENYGGNFPLYLIKLPLPPEETEGKIVLSGTPGMVA
EGLFAVDPESGFLLVTRTLDREEQSEYQLQVTLETEDGRVLWGPQPVLVDVKDENDQVPH
FSQFVYKFQLSLGTKPGIPFLFLEASDGDEPGTANSDLRFYILNQAPAQPSPHMFQLEPQ
LGALALSPEGSTSLDQAAEGLYQLLVQVKDMGDQASGHQATATVDVFIVENTWVPLDPVH
VPENLKVPYPHPIAQVHWNGGDVHYHLESQPPGPFDVDTEGKVYVTKELDRESQAEYLLQ
VRAQNTHREDYIEPLELRLVVMDDNDNAPVCSPRDSPVSIPELSPPGTKVTRLLAEDMDA
PGSLNSHIVYQLLSPEPEEGADGRAFELDFTSGSVTLGDAPLRAGQNILLRVKAVDRGGA
EGGLSSTCEVAVTITDINDHAPEFTISQIEPVSLPEDAEPGTLVATLMATDADLEPAFRL
MDFAIEAGDMEGTFGLDWEPDSSHVQLRLLKNLSYEAASSHRLVVVVRSVAELVGPGPGP
GATATVTVLVEKPVPPPRLDQSYEASVPVSTPAGSLLLTIQPSEPVSSPLRFSLLNDSEG
WLCIKEVSGEVRTARPLQGAHPGDMYTVLVEAQYEDRPTLSTSATLVIHFLKSPFAWAPT
LNPVPTRHLCTPRQDHGVVISGPREDPDPAGGHGPYSFALGPNPTVQRDWHLQALNGSHA
YLTLALHWVEPREHTVPVVVSHNTGTWQLLVQVIVCRCNVEGQCMRKVGRMKGMPSKLSA
VGILVGTLMAIGIFLILIFTHLTLARKKDLDQPVDSVPLKAAV
Download sequence
Identical sequences M3Y1P5
ENSMPUP00000005246 XP_004744379.1.14098 ENSMPUP00000005246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]