SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005391 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005391
Domain Number 1 Region: 28-103
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000377
Family Growth factor receptor domain 0.0045
Further Details:      
 
Domain Number 2 Region: 94-163
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000115
Family Fibronectin type I module 0.049
Further Details:      
 
Domain Number 3 Region: 229-273
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000034
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005391   Gene: ENSMPUG00000005430   Transcript: ENSMPUT00000005480
Sequence length 382
Comment pep:novel scaffold:MusPutFur1.0:GL896933.1:12679129:12681511:-1 gene:ENSMPUG00000005430 transcript:ENSMPUT00000005480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRTARTLAFAVTLLHLARLALSTCPAACHCPQEAPKCAPGVGLVRDGCGCCKVCAKQL
NEDCSKMQPCDHTKGLECNFGASSTALKGICRAQSEGRPCEYNSRIYQNGESFQPNCKHQ
CTCIDGAVGCIPLCPQELSLPNLGCPNPRLVKVTGQCCEEWVCDEDGAKDPMDDRDGLLG
KGLAFDASEVELTRNNELIAVGKGGSLKRLPVFGTEPRILYNPSLHGQKCIVQTTSWSQC
SKTCGTGISTRVTNDNLECRLVKETRICEVRPCGQPMYSSLKKGKKCSKTKKSPEPVTFT
YAGCSSVKKYRPKYCGSCVDGRCCTPQQTRTVKMRFRCEDGETFSKNVMMIQSCKCNYNC
PHANEAAFPFYRLFNDIHKFRD
Download sequence
Identical sequences M3Y240
XP_004752730.1.14098 ENSMPUP00000005391 ENSMPUP00000005391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]