SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005408 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005408
Domain Number 1 Region: 559-651
Classification Level Classification E-value
Superfamily DEATH domain 1.48e-22
Family DEATH domain, DD 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005408   Gene: ENSMPUG00000005448   Transcript: ENSMPUT00000005498
Sequence length 657
Comment pep:novel scaffold:MusPutFur1.0:GL896906.1:16121721:16174371:1 gene:ENSMPUG00000005448 transcript:ENSMPUT00000005498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPTPPLFSLPEARTRFTKSTREALNNKNIKPLLSTFSQLPGSENEKKCTLDQAFRGVLE
EEIINHSSCENVLAIISLAIGGVTEGICTASTPFVLLGDVLDCLPLDQCDTIFTFVEKNV
ATWKSNTFYSAGKNYLLRMCNDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSGLNLQSQ
FNLENVTVFNTNEQESTLGQKHTEDREEGMDVEEGEMGDDEAPTTCSIPIDYNLYRKFWS
LQDYFRNPVQCYEKISWKTFLKYSEEVLAVFKSYKLDDTQASRKKMEELKTGGEHVYFAK
FLTSEKLMDLQLSDSNFRRHILLQYLILFQYLKGQVKFKSSNYVLTDEQSLWIEDTTKSV
YQLLSENPPDGERFSKMVEHILNTEENWNSWKNEGCPSFVKERTSDTKPTRVARKRTAPE
DFLGKGPNKKILMGNEELTRLWNLCPDNMEACKSETREYMPTLEEFFEEAIEQADPENMV
ENEYKAVNNSNYGWRALRLLARRSPHFFQPTNQQFKSLPEYLENMVIKLAKELPPPSEEI
KTGEDEDEEDNDALLKENESPDVRRDKPVTGEQIEAFASKLGEQWKILAPYLEMKDSEIR
QIECDSEDMKMRAKQLLVAWQDQEGVHATPENLMNALNKSGLSDLAESLTNDNETNS
Download sequence
Identical sequences M3Y257
ENSMPUP00000005408 XP_004742870.1.14098 ENSMPUP00000005408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]