SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005458 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005458
Domain Number 1 Region: 237-431
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.89e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.00000000888
Further Details:      
 
Domain Number 2 Region: 64-204
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 3.01e-24
Family CRAL/TRIO domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005458   Gene: ENSMPUG00000005499   Transcript: ENSMPUT00000005549
Sequence length 439
Comment pep:novel scaffold:MusPutFur1.0:GL896991.1:1432201:1448598:1 gene:ENSMPUG00000005499 transcript:ENSMPUT00000005549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLSELQDDLTLDDTSQALNQLKLASIDEKNWPSDEMPDFPKSDDSKSSSPEPVTHLKW
DDPYYDIARHQIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDY
TLLYLHHGLTSDNKPSLSWLRDAYREFDRKYKKNIKALYIVHPTMFIKTLLILFKPIISF
KFGQKIFYVNYLSELSEHVKLEQLGIPRQVLKYDDFLKSTQKSPATAPKPMPPRPPLPNQ
QFGVSLQHLQEKNPEQEPIPLVLRETVAHLQAHALTTEGIFRRSANTQVVREVQQKYNMG
LPVDFDQYNDLHLPAVILKTFLRELPEPLLTFDLYPHVVGFLNIDESQRVEATLQALQAL
PEENYQVLRFLVAFLVQISAHCDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFT
KFLLDHHGELFPSPDSRGL
Download sequence
Identical sequences M3Y2A7
XP_004763180.2.14098 ENSMPUP00000005458 ENSMPUP00000005458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]