SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005483 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000005483
Domain Number - Region: 72-266
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 0.0143
Family PhyH-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005483   Gene: ENSMPUG00000005525   Transcript: ENSMPUT00000005575
Sequence length 296
Comment pep:novel scaffold:MusPutFur1.0:GL897124.1:868142:926110:-1 gene:ENSMPUG00000005525 transcript:ENSMPUT00000005575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APRSSRPRARPSRAAAVEAEPAKEEDPEKTNLYPPSQTPGEGLSPGGGLRPNGQTKPLPA
LKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKD
IRGDKITWIEGKEPGCEAIGLLMSSMDDLIRHCNGKLGNYRINGRTKAMVACYPGNGTGY
VRHVDNPNGDGRCVTCIYYLNQDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDR
RNPHEVQPAYSTRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSISKDVL
Download sequence
Identical sequences M3Y2D2
ENSMPUP00000005483 ENSMPUP00000005483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]