SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005488 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005488
Domain Number 1 Region: 8-98
Classification Level Classification E-value
Superfamily DEATH domain 8.95e-16
Family Caspase recruitment domain, CARD 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005488   Gene: ENSMPUG00000005530   Transcript: ENSMPUT00000005580
Sequence length 217
Comment pep:known scaffold:MusPutFur1.0:GL896910.1:18160896:18161714:1 gene:ENSMPUG00000005530 transcript:ENSMPUT00000005580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APTMGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERR
VRRLLLLVQSKGEFACQELLHCAQRTTRTPDPAWDWQHVGAGYRERSYDTSCPGHWTPEA
PGLRTTCPELPRASDCEEAGVPGGSEAVQSGTPEELNPELEAGASEEAEQDVEPEPEAEA
EPEPELEPEPEPELEPEPEPEPEPEPDFEAGDESEGV
Download sequence
Identical sequences M3Y2D7
ENSMPUP00000005488 ENSMPUP00000005488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]