SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005575 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005575
Domain Number 1 Region: 587-822
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 5.89e-84
Family Fibrinogen C-terminal domain-like 0.00000000464
Further Details:      
 
Domain Number 2 Region: 46-235
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 6.98e-68
Family Fibrinogen coiled-coil and central regions 0.00000735
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005575   Gene: ENSMPUG00000005620   Transcript: ENSMPUT00000005672
Sequence length 825
Comment pep:novel scaffold:MusPutFur1.0:GL897066.1:1947570:1955621:-1 gene:ENSMPUG00000005620 transcript:ENSMPUT00000005672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSVKNFCLVLSVVGTVWTTNVKESEFIAEGAVARGPRIVERQQSTCKETDWPFCADEDW
NYRCPSGCRMKGLIDEVNQDFTNRINKLKNSLFDYQKNNKDSNSLTGNVMELVRGDFASA
NNNDNTYSQVTEDLRSKIEILRRRVIEQVQQIRLLQKNVRDQLVDMKRLEVDIDIKIRSC
QGSCSRALERRTDLKYYEDQQKQLEQVIAKDLLPPKNRQQLPQLKMSRAPNTLPGDFKSQ
LKNVPPEWRALMETQQMKITFEGSGRDGNTRGDTASHGTGSVPENPRNPGSSTPGSSGTW
NPGSTRPDSDGSWSSGSTGTTSSSSWSSGSSVSTGTWNAGSTGTGSTGPWSPGSSESGSF
RPDSVGHGNSRPINPDWGKFEEVSGSVTPGTKKEFHTGKLVTSKGDKELVIGNERVTSGS
GTTTRRSCSKTVTKTVIGPDGHKEVTKEVVNSEDGSDCGDLPHSFAGSLDDLHSRHPDLE
SFFGTSSTRNIFPGALSPSHREFDSRTHALGSESDIFTHFGASEFPSSGKTSSHSKQFSS
SSTTFNRGDSTFESKSYKVAGEAGTEEEHETLKGGYTTKRGHAKVRSARDCDDVLQIHPS
GAQSGIFNIKLPGSSKIFSVYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYKKGFGSLDD
KGEGEFWLGNEYLHLLTLRGSVLRVELEDWAGNQAYAEYHLRVGSEAEGYTLQVSSYEGT
AGDALIEGSAEEGTEYTSHADMQFSTYDRDRDQWEENCAEVYGGGWWYNSCQAANLNGIY
YPGGSYDPRNNSPYEIENGVVWVPFRGADYSLRAVRMKIRPLVTQ
Download sequence
Identical sequences M3Y2M4
ENSMPUP00000005575 XP_004772068.1.14098 ENSMPUP00000005575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]