SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005585 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005585
Domain Number 1 Region: 66-427
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.18e-82
Family Ankyrin repeat 0.00000899
Further Details:      
 
Domain Number 2 Region: 445-540
Classification Level Classification E-value
Superfamily DEATH domain 1.35e-19
Family DEATH domain, DD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005585   Gene: ENSMPUG00000005630   Transcript: ENSMPUT00000005682
Sequence length 555
Comment pep:novel scaffold:MusPutFur1.0:GL897022.1:4177543:4238588:-1 gene:ENSMPUG00000005630 transcript:ENSMPUT00000005682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPGQSILGHRAAARELLQGAAAAVKGLGEDLRGAASRPWIPKREAPREAAAAAGHEILL
PNERNFQNAAKSNNLDLMEKLFEKKVNINAVNNMNRTALHFAVGANHISAVDFLLNHKAR
VDIADKHGLTVLHLAAWSGSLEIMLMLIRAGADQRAKNEDGMNALHFAAQSNNVRIVEYL
IQDLHLKDLDQPDEKGRKPFLWAAERGHTEMIEKLIFLNLHTSEKDKEGNAALHLAAKHG
HSPVVRVLLTQWQETNEINENGETPFFLAVKGGHEECSKVLLAAGSDVNIPNKHNITALE
MATQNGHPSLVRCLLGENVDLHQNMELKDSPLHLAVINNHISVVNSLIRAQHDVDTLNQR
RQTPLHVAADLGNVELVETLLKARCDLKIVDKQGKTALAVASRSNHSLVVDMIIKAERYY
AWKEQHGENIRDPSTRFTLTFKQDHSLETRHIRSLLWKLAYQQLKANEWQRLARSWNFTD
DQIRAIEEQWTGKGSFREHGHRALLIWLHGTLMTQATPVKHLYEELIRAGFPELAEKIRR
QKNETDSRSKKCAVS
Download sequence
Identical sequences M3Y2N4
ENSMPUP00000005585 XP_012919169.1.14098 ENSMPUP00000005585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]