SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005629 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005629
Domain Number 1 Region: 104-159
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000432
Family TSP-1 type 1 repeat 0.00036
Further Details:      
 
Domain Number 2 Region: 159-214
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000249
Family TSP-1 type 1 repeat 0.00052
Further Details:      
 
Domain Number 3 Region: 56-99
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000706
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 4 Region: 214-269
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000131
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000005629
Domain Number - Region: 640-828,857-938
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00796
Family Rhodopsin-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005629   Gene: ENSMPUG00000005674   Transcript: ENSMPUT00000005726
Sequence length 1284
Comment pep:novel scaffold:MusPutFur1.0:GL897045.1:2487816:2933699:1 gene:ENSMPUG00000005674 transcript:ENSMPUT00000005726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTHKLSYTFILSLEFGMMGDHTIKSQRPRSVHEKRVPQEQADAAKFMAQTGESGVEEWS
QWSTCSVTCGQGSQVRTRTCVSPYGTHCSGPLRESRVCNNTALCPVHGVWEEWSPWSLCS
FTCGRGQRTRTRSCTPPQYGGRPCEGPETHHKPCNIALCPVDGQWQEWSSWSQCSVTCSN
GTQQRSRQCTAAAHGGSECRGPWAESRECYNPECTANGQWNQWGHWSGCSKSCDGGWERR
MRTCQGAAVTGQQCEGAGEEVRRCSEQRCPAPYEICPEDYLMSMVWKRTPAGDFAFNQCP
LNATGTTSRRCSLSLHGVAFWEQPSFARCISNEYRHLQHSIKEHLAKGQRTLAGDGMSQV
TKTLLDLTQRKNFYAGDLLMSVEILRNVTDTFKRASYIPASDGVQNFFQIVSNLLDEENK
EKWEDAQQIYPGSIELMQVIEDFIHIVGMGMMAFQNSYLMTGNVVASIQKLPAASVLTDI
NFPMKGRKGMVDWARNSEDRVVIPKSIFTPVSSKESDESSVFVLGAVLYKNLDLILPTLR
NYTVVNSKIIVVTIRPEPKTTDSFLEIELAHLANGTLNPYCVLWDDSKTNESLGTWSTQG
CKTVLTDASHTKCLCDRLSTFAILAQQPREIIMESSGTPSVTLIVGSGLSCLALITLAIV
YAALWRYIRSERSIILINFCLSIISSNILILVGQTQTHNKSICTTTTAFLHFFFLASFCW
VLTEAWQSYMAVTGKIRTRLIRKRFLCLGWGLPALVVATSVGFTRTKGYGTDHYCWLSLE
GGLLYAFVGPAAAVVLVNMVIGILVFNKLVSRDGILDKKLKHRAGQMSEPHSGLTLKCAK
CGVVSTTALSATTASNAMASLWSSCVVLPLLALTWMSAVLAMTDKRSILFQILFAVFDSL
QGFVIVMVHCILRREVQDAFRCRLRNCQDPINADSSSSFPNGHAQIMTDFEKDVDIACRS
VLHKDIGPCRAATITGTLSRISLNDDEEEKGTNPEGLSYSTLPGNVISKVIIQQPTGMHM
PMSMNELGNQCLKKENSELRRTVYLCTDDNLRGADMDMVHPQERMMESDYIVMPRSSVNT
QPSMKEESKMNIGMETLPHERLLHYKVNPEFNMNPPVMDQFNMNLDQHLAPQEHMQNLPF
EPRTAVKNFMASELDDNAGLSRSETGSTISMSSLERRKSRYSDLDFEKVMHTRKRHMELF
QELNQKFQTLDRFRDIPNTSSMENPAPNKNPWDTFKNPSEYQHYTTINVLDTEAKDALEL
RPAEWEKCLNLPLDVQEGDFQTEV
Download sequence
Identical sequences M3Y2S8
ENSMPUP00000005629 ENSMPUP00000005629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]