SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005648 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005648
Domain Number 1 Region: 196-311
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.57e-37
Family CAD domain 0.00000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005648   Gene: ENSMPUG00000005695   Transcript: ENSMPUT00000005747
Sequence length 416
Comment pep:novel scaffold:MusPutFur1.0:GL896946.1:6491157:6495941:1 gene:ENSMPUG00000005695 transcript:ENSMPUT00000005747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRRRVAQLAHAVSPQVAVDGGRRGEQQRGQPDGQEQAAGQGWAAQPGRQERPGDGQAAL
QAEQAGEQHAGVHAERARVVHRLAARLAQRPRLARQEGHEERREQQHRAVGQRQVQHERG
RQRSPPCGPPAHQAPHDEAVAGQPQQRRQQQEGRARDPRGLPAQQCLVPWGPSTAKNHGA
QKSLGEATLLLLPSTMEYLSALNPSGLLRSVSSMGSEFGRKVWTSASPPQRPFRVCDHKR
TTRKGLTAATRQELLDKALEALLLSGMLTLVLEEDGTAVESEDFFQLLEDDTCLMVLECG
QNWSPSRSGMRSYGLGREKPKHSKDIARITFDVYKQNPRDLFGSLNIKATFYGLYSMSCD
FQGLGPKKVLRELLRWTSALLQGLGHMLLGIASSLRHVVEGTEQWHWQRQGRLHPY
Download sequence
Identical sequences M3Y2U7
ENSMPUP00000005648 XP_004755264.2.14098 ENSMPUP00000005648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]