SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005758 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005758
Domain Number 1 Region: 3155-3329
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.45e-30
Family Laminin G-like module 0.00093
Further Details:      
 
Domain Number 2 Region: 2984-3147
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.95e-28
Family Laminin G-like module 0.0019
Further Details:      
 
Domain Number 3 Region: 2757-2927
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.76e-21
Family Laminin G-like module 0.015
Further Details:      
 
Domain Number 4 Region: 2583-2755
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.32e-20
Family Laminin G-like module 0.0056
Further Details:      
 
Domain Number 5 Region: 2383-2575
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000107
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 6 Region: 1351-1402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000226
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 7 Region: 1734-1784
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000053
Family Laminin-type module 0.045
Further Details:      
 
Domain Number 8 Region: 529-574
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000558
Family Laminin-type module 0.0063
Further Details:      
 
Domain Number 9 Region: 1261-1309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000977
Family Laminin-type module 0.0067
Further Details:      
 
Domain Number 10 Region: 484-531
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000446
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 11 Region: 1682-1724
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000201
Family Laminin-type module 0.0067
Further Details:      
 
Domain Number 12 Region: 292-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000544
Family Laminin-type module 0.051
Further Details:      
 
Domain Number 13 Region: 624-674
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000837
Family Laminin-type module 0.0082
Further Details:      
 
Domain Number 14 Region: 349-405
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000223
Family Laminin-type module 0.033
Further Details:      
 
Domain Number 15 Region: 419-461
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000893
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 16 Region: 677-718
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000725
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 17 Region: 1400-1448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000893
Family Laminin-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000005758
Domain Number - Region: 1643-1684
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000558
Family Laminin-type module 0.025
Further Details:      
 
Domain Number - Region: 572-626
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00156
Family Laminin-type module 0.012
Further Details:      
 
Domain Number - Region: 97-178
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00255
Family APC10-like 0.057
Further Details:      
 
Domain Number - Region: 1854-1945
Classification Level Classification E-value
Superfamily Tropomyosin 0.0144
Family Tropomyosin 0.015
Further Details:      
 
Domain Number - Region: 1313-1348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0145
Family Laminin-type module 0.031
Further Details:      
 
Domain Number - Region: 2260-2374
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0915
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005758   Gene: ENSMPUG00000005805   Transcript: ENSMPUT00000005857
Sequence length 3330
Comment pep:novel scaffold:MusPutFur1.0:GL896906.1:18661484:18927463:1 gene:ENSMPUG00000005805 transcript:ENSMPUT00000005857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAARVPGWVLRPVLLLLLLLLLPPAVNAAREPRTAARLRLHPPYFNLAEAARISATAT
CGEREPGGARPELYCKLVGGPTAAVSGHTIQGQFCDYCNSEDPRRAHPVTNAIDGSERWW
QSPPLSSGTQYNKVNVTLDLGQLFHVAYLIIKFANSPRPDLWVLERSVDFGSTYSPWQYF
AHSKIDCLEQFGQEPNMAITQDDDVLCTTEYSRIVPLENGEIVVSLINGRPGAKNFTFSH
TLREFTMATNIRLCFLRTNTLLGHLISKAERDPTVTRRYYYSIKDISIGGRCVCNGHAQD
CSANNPEKLFQCECQHHTCGKTCDRCCAGYNQRHWRPATWEQSNECEACNCHGHALDCYY
DPDVERQQASLNIHGIYAGGGVCINCQHNTAGINCENCAKGYYRPYGVPVDAPHGCIPCS
CNPAHADDCEPGSGRCTCKPNFQGDNCEKCAVGYYRFPFCLRIPIFPISTPSPEDPIAGD
IKGCDCDLEGVLPEICDAYGRCLCRPGVEGRRCDACRLGFYSFPICQACQCSVLGSYEMP
CNPVTGQCECLPGVTGQRCDRCLSGAYDFPHCQDFTGRCDPDGTLDSKLGHCQCKAHVES
PSCSICKPLYWNLAKENPNGCSECQCHVAGTVSGIGECGQRDGDCHCKSHVSGDSCDTCE
DGYFALERSNYFGCQGCQCDVGGAISPLCSGPSGGCRCREHVVGTACQRPENNYYFPDLH
HMKYEIEDGTTPNGRELRFGFDPLEFPEFSWRGYAQMTSVQNEVRITLNVGKSSHSLFRV
ILKYVNPGTEAVSGRVTIYPYRAEAGAAQSKEVIFLPRKEPAFVTVPGNGVAEQFSITPG
TWIACIKSEGVLLDYLVLLPRDYYEASSLQLPVTQPCADSGPLQENCLLYQHLPVTRFPC
ALACEARHFLLDGEPRALAVRQPTPAHPVMADLSGREVELHLRLRVPHVGNYVVVLQYST
EVDQLSVVDVHMESPGSVLAGQVNIYSCKYSVLCRSVVTDGRSRLAVYELLADAGIRLRA
RRARFLLHQICIIPIEEFSTEYLRPEVKCIASYGGYVNQSASCVSLVPETPPTALILDVP
RGEPSPFLPQDPLPSADVTGVILKAPQNQVTLRGLVPRLGRYVIVIHFYQPAHPAFPTQV
FVDGGRPWPGVFRASFCPHVLGCRDQVIAEDQVELDISKQEVAVTVKVPEGKSLVLVRVL
VVPAEDYDYQILHKKSVDKSFEFINSCGRNSFYIDPQTASGFCKNSARSLVALYHKGALP
CECHPTGSIGHHCSPEGGQCPCRPSVIGRQCTRCRTGYYGFPHCKPCNCGPHLCEEMTGK
CLCPPRTVRPQCEMCDVHSFSFHPLAGCEGCNCSRRGSVGVTTPECDRDHGQCRCKPRVT
GRQCDRCASGFYHFPECLPCHCNRDGTEPGVCDPGTEACLCKENVAGTECNVCREGSFYL
DPANPKGCTRCFCFGISNHCHSTHKRRAKFVDMMGWRLETADGTDIPVSFNPGSSSVVAD
LQELPSTVHSASWVAPLSYLGDKVSSYGGFLTYQIKSFGLPGDMVLLEKMPDVQLTGQHM
SIIYKEPSNPRPDRLYHVRVQVVEGNFRHASSGGPVTREELMMVLSSLEDLRLRGLYFTE
TQRLSLSGVGLEEASDTGSGRRAHNVEMCSCPPHYTGDSCQGCSPGYYRVNEGPYTRRCA
PCNCNGHSSRCQDGSGTCINCQHNTAGEHCEHCKEGHYGNAIQGSCSVCPCPHSNSFATG
CVVNGGNVRCFCKPGYTGTQCERCAPGYFGTPQKLGGSCQPCNCNSNGHPGSCHPLTGDC
LNQEPKDGGPGEECDDCDSCVMTLLNDLAAMGNELHLVKSQLHGLSTSTGSLEQMKHLET
QIKDLRNQLLTYRSAISNHGLKMDGLEKELGSLNHEFETLQEKVQVNSRKAQALHNNVDQ
TIQSAKELDTKIKNVIQNVHILLKQISGTNGEGNNLPPGDFSREWAEAERMMRELRNRDF
GKQLKKAEADKREARLLLTRIKSWLEQHQGENSALVKSLRDSLHDYEAKLSDLRAMLQKA
AAQAKQATGLNQENEKALESIKTQIQQTNSLRSDLSKYLATADSSLLQTNVLLQQMRESQ
EEYEKLAATIKEERHRLNDKVRELSRSTSKASLVAEAEAHAQSLQELAKQLEEIKRNTSG
NELVRCAVDAATAYENILNAIKAAEDAANKATSASESALQTVIKEDLPGKAKTLSSDSDK
LLKQAKITEKQLRQEISPALNNLQQTLKVITVQKGLIDTNITAIRDDLRGIQRGDISGMI
SSAKSMVRNANDITNEVLDGLGPIQTDVTRIKDTYGSTQREDFNKALTDADNSVKKLTNK
LPDILSKIESINQQLLPLGNISDNVDRIRELIQQARDAANKVAIPMRFNGKSGVEVRVPN
DLEDLKGYTSLSLFLQRPDSREYGRTENMFVMYLGNKDASKDYIGMAVIDGKLSCVYNLG
EQESELQVDQSVTKSETQEAVMDRVKFQRIYQFASLNYTKKATSIKPGTSQFHEMDGGSS
HTLLNLDPENVVFYVGGYPPDFRLPARLRFPPYKGCIELDDLNENVLSLYNFKQTFNLNT
TEVEPCRRRKEESDRNYFEGTGYARVPTQPNAPIPTFGQVIQTTMDRGLLFFAENKDRFI
SLDIEDGKLLVRYKLNSEPPKEKEVTQVVNNGKDHSIQIIIGKTQKLMRINVDLVGSLIH
GDIFDFSTYYLGGIPISIRERFNISTPAFRGCMKNLKKTTGVVRLNDTVGVTKKCSEDWK
LVRSASFSRGGQLRFTNVDLPLPNEFQASFGFQTFQPSGMLLNLQAQTRSLQISLEEGHI
ELNTRDSSRPIFKTPQTYTDGSLHYVSVISDHSGLRLLIDDQTLKSNQRLQDLSGSQYPL
YLGGSHFEGCISNVFIRRQSESPAVLDLTNKTFKRDVSLGGCSLNPPPFLLLLRGSTRLN
KSHTFNINQPLQDTPVASPRRMEIWREAQSCLPPPGAQASHGALRFGDRPTSHLLFTIPQ
ELVTNRSRFAVDVQTASSRGLVFFTGTQQSYMALYLSKGRLVFVLGADGKKLKLKSKEKC
NDRQWHTVVFGQDGEKGHLVVDGLRVREGSLPGNSTVSLRAPIYLGSSPSGKPKSLPQNS
FVGCLRNFQLDQKPLDTPSLSVGVSPCLGGSLEKGIYFSQEGGHVVLANSVLLGPEFKLV
FSIRPRSLTGILIHVGSRPGRHLCVYLEAGKVTASVDSEAGGILASVTPKRSLCDGRWHS
VTVTIKQHILHLELDAENSYTAGRLPFPPADTREPLHIGGVPAGLKTLKLPVWESFFGCL
KNIQVNHVPIPVTEALDIQGTVSLSGCPHH
Download sequence
Identical sequences M3Y357
XP_004742898.1.14098 ENSMPUP00000005758 ENSMPUP00000005758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]