SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Mustela putorius furo 69_1.0 > ENSMPUP00000005777

Domain assignment for ENSMPUP00000005777 from Mustela putorius furo 69_1.0

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSMPUP00000005777
Domain Number 1	Region: 110-175
Classification Level	Classification	E-value
Superfamily	Chromo domain-like	3.26e-26
Family	Chromo domain	0.0000561
Further Details:

Domain Number 2	Region: 14-74
Classification Level	Classification	E-value
Superfamily	Chromo domain-like	4.34e-23
Family	Chromo domain	0.00019
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSMPUP00000005777 Gene: ENSMPUG00000005824 Transcript: ENSMPUT00000005876
Sequence length	191
Comment	pep:novel scaffold:MusPutFur1.0:GL897098.1:812234:837146:1 gene:ENSMPUG00000005824 transcript:ENSMPUT00000005876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCP ELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNNADDIKSKKKREQSNDIARGFERG LEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPED AENKEKETAKS
Download sequence
Identical sequences	A0A2I2U2I6 E2QYK6 M3Y376 ENSFCAP00000009423 XP_003433614.1.84170 XP_003988838.1.62641 XP_003988839.1.62641 XP_004406243.1.74151 XP_004406244.1.74151 XP_004406245.1.74151 XP_004774613.1.14098 XP_004774614.1.14098 XP_004774615.1.14098 XP_004774616.1.14098 XP_005636804.1.84170 XP_006728766.1.47382 XP_006728767.1.47382 XP_006728768.1.47382 XP_006933823.1.62641 XP_006933824.1.62641 XP_007081475.1.5354 XP_007081476.1.5354 XP_007081477.1.5354 XP_007081478.1.5354 XP_007081479.1.5354 XP_008702902.1.72690 XP_008702903.1.72690 XP_013963925.1.84170 XP_014943299.1.86478 XP_014943300.1.86478 XP_014943301.1.86478 XP_014943302.1.86478 XP_014943303.1.86478 XP_015392749.1.5354 XP_019275152.1.44245 XP_019275153.1.44245 XP_019275154.1.44245 XP_019275155.1.44245 XP_019275156.1.44245 XP_019690592.1.62641 XP_021542465.1.83697 XP_534787.3.84170 ENSCAFP00000009868 ENSMPUP00000005777 9615.ENSCAFP00000009868 ENSCAFP00000009868 ENSMPUP00000005777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]