SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005880 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005880
Domain Number 1 Region: 39-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.24e-38
Family SCAN domain 0.0000505
Further Details:      
 
Domain Number 2 Region: 490-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.79e-23
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 3 Region: 591-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-18
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 405-447,476-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.68e-18
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 5 Region: 231-292
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000000549
Family KRAB domain (Kruppel-associated box) 0.0038
Further Details:      
 
Domain Number 6 Region: 546-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000145
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005880   Gene: ENSMPUG00000005930   Transcript: ENSMPUT00000005983
Sequence length 648
Comment pep:novel scaffold:MusPutFur1.0:GL896924.1:11813575:11831961:-1 gene:ENSMPUG00000005930 transcript:ENSMPUT00000005983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATALEPEDQDLWEEEGILMVKLEDDFTCRPESVLQRDDPVLETSHQNFRRFRYQEAASP
REALIRLRELCHQWLRPERRTKEQILELLVLEQFLTVLPGELQSWVRGQRPESGEEAVTL
VEGLQKQPRRPRRWVTVHVHGQEVLSEETVHPGAEPESPSELQNPVQISTPEASCEETVQ
SPDLRPLEEQSLCHELEFQPLQESEVLASQDPDLPEERSTGNPEMVALLTALSQGLVTFK
DVAVCFSQDQWSDLDPAQKEFYGEYVLEEDCGIVVSLSFPIPRLDEISHVREEEPLVPDI
PEPQEPQEPEILSFTYTGDRSEDEEDYLEQEDLSLEDLHRSILGDPEIHQTPDWEIVFED
DPNRLNERRFGTNISQVNSLSNLRETMPLHPLLGRHHDCPVCGKSFTCNSHLVRHLRTHT
GEKPYKCMECGKSYTRSSHLARHQKVHKMGTSYKFPLNRKNLDETSPLVQAERTPHVEKP
YRCDDCGKHFRWTSDLVRHQRTHTGEKPFFCTICGKSFSQKSVLTTHQRIHLGGKPYLCG
ECGEDFSDHRRYLAHRKTHAAEELYLCSECGRCFNHSAAFAKHLRGHASVRPCRCTECGK
SFSRRDHLVRHQRTHTGEKPFTCPTCGKSFSRGYHLIRHQRTHSEKTS
Download sequence
Identical sequences M3Y3H9
ENSMPUP00000005880 XP_004750167.1.14098 XP_004750168.1.14098 XP_004750169.1.14098 XP_004750170.1.14098 ENSMPUP00000005880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]