SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005881 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005881
Domain Number 1 Region: 42-160
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000157
Family Growth factor receptor domain 0.0015
Further Details:      
 
Domain Number 2 Region: 144-196
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000301
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005881   Gene: ENSMPUG00000005931   Transcript: ENSMPUT00000005984
Sequence length 243
Comment pep:known scaffold:MusPutFur1.0:GL897061.1:2275950:2431119:1 gene:ENSMPUG00000005931 transcript:ENSMPUT00000005984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFRLFSFALIILNCMDYSHCQGNRWRRSKRASYVSNPICKGCLSCSKDNGCSRCQQKLF
FFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLH
RGRCFDECPDGFAPLDESMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKP
AKDTIPCPTIAESRRCKMALRHCPGGKRTPKAKEKKNKKKKRKLIERAQEQHSVFLATDR
ANQ
Download sequence
Identical sequences M3Y3I0 U6CRX3
ENSMPUP00000005881 ENSMPUP00000005881 XP_012900663.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]