SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006130 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000006130
Domain Number - Region: 262-350
Classification Level Classification E-value
Superfamily DEATH domain 0.000106
Family DEATH domain, DD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006130   Gene: ENSMPUG00000006182   Transcript: ENSMPUT00000006237
Sequence length 352
Comment pep:known scaffold:MusPutFur1.0:GL897008.1:1369467:1371607:1 gene:ENSMPUG00000006182 transcript:ENSMPUT00000006237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPLCLLLPAALLLVQVVPQEASQHCGRLEYWNPDNRCCSSCLQRFGPPPCPDFEFSENC
GLNDSGDHMSLPFKECPFGQCNPDSAELCSPCGGGATASAPAGSRSGTQQRCPQRSIPPK
GPCPLKSGKPDVLSSQDPSPSPISSLSWTSERSVTQVLPNFALPVVLVFAGLVLLVTSAV
VLLVAQRCHRQAKVVLHPYPGLVCEDTNIHTLLFSPHLSSPASLEASETGDSRKEVALVP
LLGRELPNLASQPLSRLLDELEVLEELIVLLDPEPGPGGGMACGTTRHLAARYGVPAAWS
TFAYSLRPSRSPLRALIEMVVAREPSASLGQLGTHLAQLGRADALQVLSKLG
Download sequence
Identical sequences G9KTV7
ENSMPUP00000006130 XP_004765154.1.14098 ENSMPUP00000006130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]