SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006283 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006283
Domain Number 1 Region: 14-82
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000276
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006283   Gene: ENSMPUG00000006337   Transcript: ENSMPUT00000006392
Sequence length 813
Comment pep:novel scaffold:MusPutFur1.0:GL896972.1:2971819:3009348:1 gene:ENSMPUG00000006337 transcript:ENSMPUT00000006392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGAGVMDGMPKTLLARALFDNHPDCSYELAFCRGDILTILEQNVPESEGWWKCLLHGRQ
GLAPANRLQILPEAPADRPCAPLLRGLEEPLTCSKDTYQVPTLLKPPTAGPVYEDMRSWV
EGPPRTATQVYEFPDPPAGARIVCEKTLSFPKQALFTMPRPARASLPTLPSQVYDVPAQS
RGPPALKEPEKRQLYDIPPSPQKAGLGPSASQLSGQCVPPTSAIAPRRGGYSTLPSPQKS
EWIYDWPVSPEKAEGTNASLSSFVEESEPHRPPGPMSSFQNPLNSRTWSHYPHLHKNVPM
QKKLSLPEIPSYQALAPRDTFPLDEDAGYKVPSSFLIPRVEQQNTKPNIYDIPKATPSDP
QAVNEPGRVGGAPEIAADGSSSWFSGRAPSLSPDSDRLSVSSSDSRASVVSSCSSTSTDS
SSGSCLEESGKELSLDPDLARETVVALQHEVASSVASLMLFVSRKWRFRDYLEANLSAIR
SAADRVEESLRAFLDFARGVRGTACNLSDTNLQARIRDQLQTISSSYQILLGTKESLDNC
KWSLEVLVTDKVQNSPDDLERFVMVARMVPEDIKRFASIVIANGRLLFKQNCEKEDTLQM
TPHGQLKPAKCIQLPQREMEPYEGSTPFNKQKENEHSPELLKKNGTIMCEPKSSNLEETE
TPISEGRSDENKNWEGQNPSSLILQPLSQQNPEKRFQLSEHCRLYFGALFKAISVFNHSL
SNSQPPEVFITQSKLVIMVGQKLVDTLCKETQERDVRNEILCGSSHLCSLLKNLALATKH
AVLKYPSPAALGHLQAEAQKLEQHTRQFRGTLE
Download sequence
Identical sequences M3Y4N2
ENSMPUP00000006283 ENSMPUP00000006283 XP_004759947.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]