SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006303 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006303
Domain Number 1 Region: 166-421
Classification Level Classification E-value
Superfamily Caspase-like 1.64e-74
Family Caspase catalytic domain 0.000000083
Further Details:      
 
Domain Number 2 Region: 19-88
Classification Level Classification E-value
Superfamily DEATH domain 0.0000765
Family Caspase recruitment domain, CARD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006303   Gene: ENSMPUG00000006357   Transcript: ENSMPUT00000006412
Sequence length 422
Comment pep:novel scaffold:MusPutFur1.0:GL897004.1:4523513:4536021:1 gene:ENSMPUG00000006357 transcript:ENSMPUT00000006412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLTEKRSLQDPVKEIKMIASTMLGGFLEDLKEKKVLDKRDLQTIGKKVNFIVNKTENLVD
DLSEKTQVVGQVFMDRLVNSKSLLSLSWGYTNAEEDKWWYLTSFGARVKKTMDGREELEL
RAQGESLRHEESYFFLSVIQEIQDSSMDMVKICPCKHSQEPKTVRVQEVYPVMEKEGRTR
LALIICNKVFDHLSEREGSENDILGMQGLLENLGYSVVIKENLTALEMITELKNFATRPE
HQFSDSTFLVFMSHGTLDGICGRKHRDEEPDILPDDTIFQIFNNRSCHGLKDKPKVIITQ
ACRGKGDGAVWVTDMGEALAWTCYQPLERYISSDAIKKTHVEKDFIAFKSSTPHNVSWRL
NTKGSIFISQLIHYLGEYSCCHHLEEIFRKVQNAFEKPNAMIQMPTIERLSMTRYFYLFP
GN
Download sequence
Identical sequences M3Y4Q2
ENSMPUP00000006303 ENSMPUP00000006303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]