SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006327 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006327
Domain Number 1 Region: 12-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.53e-19
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 2 Region: 206-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000215
Family Classic zinc finger, C2H2 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006327   Gene: ENSMPUG00000006381   Transcript: ENSMPUT00000006436
Sequence length 270
Comment pep:novel scaffold:MusPutFur1.0:GL897135.1:547450:555328:-1 gene:ENSMPUG00000006381 transcript:ENSMPUT00000006436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MECCPFLAADGGLVVFTDVAIHFSREEWGLLDEAQRSLYHSVMLETLALLSSLGCWHGAQ
DEAAPLEQGDSVGGSQVRTPTQKSQPWERCSMLWKDFLRWAERDGTRPERGPQTCGGKHL
QHQKQQIREKLSRSGEGRRPFVKNCRGHVTETGFIRRDSGNAIPASSGLLQPQVPHVIRK
PYWDTGGGEAFLNEQNYCKCTPCGKTFSHKHIFVDREKSPRRGKLYEYREFGRAFLRKSH
PCQHLKGYDEDRLYENPECGRFFTQITWPR
Download sequence
Identical sequences M3Y4S6
ENSMPUP00000006327 XP_012903573.1.14098 XP_012903574.1.14098 ENSMPUP00000006327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]