SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006386 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006386
Domain Number 1 Region: 326-403
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 3.14e-25
Family Intermediate filament protein, coiled coil region 0.00027
Further Details:      
 
Domain Number 2 Region: 96-130
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000126
Family Intermediate filament protein, coiled coil region 0.0017
Further Details:      
 
Domain Number 3 Region: 132-202
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000889
Family Intermediate filament protein, coiled coil region 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000006386
Domain Number - Region: 220-327
Classification Level Classification E-value
Superfamily Prefoldin 0.000123
Family Prefoldin 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006386   Gene: ENSMPUG00000006441   Transcript: ENSMPUT00000006497
Sequence length 510
Comment pep:novel scaffold:MusPutFur1.0:GL897098.1:2059425:2066460:1 gene:ENSMPUG00000006441 transcript:ENSMPUT00000006497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSAFSRVGGSFRGGLNSSMSVVGGYG
GGAGGMGGITAVSVNQSLLSPLKLEVDPNIQAVRTQEKEQIKTLNNKFASFIDKVRHLEQ
QNKVLETKWSLLQQQKTARSNIDNMFESYISNLRRQLDTLGQEKLKLEVELGNMQGLVED
FKNKYEEEIKERADMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIRE
LQSQISDTSVVLSMDNSRSLDLDGIISEVKAQYEDIANRSRAEAETMYQIKYEELQTLAG
KHGDDLRRTKTEISEMNRSISRLQAEIEALKNQRAALEAAIADAEQRGELAIKDANGKVA
ELEAALQRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESRLESGMQNMSIHTK
TTSGFSGECLGLGSGGQEGRRAGPFYTGGLSSTYGALPSPSLNYGLSSFQSSFGPSGSFS
RGSSSKAVVVKKIETRDGKLVSESSDVLSK
Download sequence
Identical sequences M3Y4Y5
ENSMPUP00000006386 ENSMPUP00000006386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]