SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006597 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006597
Domain Number 1 Region: 958-1171
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-103
Family Thrombospondin C-terminal domain 0.0000000059
Further Details:      
 
Domain Number 2 Region: 30-230
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.31e-40
Family Laminin G-like module 0.0000124
Further Details:      
 
Domain Number 3 Region: 835-957
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.83e-35
Family TSP type-3 repeat 0.000000487
Further Details:      
 
Domain Number 4 Region: 766-837
Classification Level Classification E-value
Superfamily TSP type-3 repeat 9.68e-17
Family TSP type-3 repeat 0.00024
Further Details:      
 
Domain Number 5 Region: 494-545
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 5.89e-16
Family TSP-1 type 1 repeat 0.00012
Further Details:      
 
Domain Number 6 Region: 437-492
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000109
Family TSP-1 type 1 repeat 0.0000925
Further Details:      
 
Domain Number 7 Region: 319-376
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000157
Family VWC domain 0.0053
Further Details:      
 
Domain Number 8 Region: 693-778
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000811
Family TSP type-3 repeat 0.00013
Further Details:      
 
Domain Number 9 Region: 383-431
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000235
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 10 Region: 550-603
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000117
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006597   Gene: ENSMPUG00000006651   Transcript: ENSMPUT00000006710
Sequence length 1173
Comment pep:novel scaffold:MusPutFur1.0:GL897047.1:4893126:4912660:-1 gene:ENSMPUG00000006651 transcript:ENSMPUT00000006710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NALWACARPVCWQSLCSVPTAAGAQDEDMAFDLFSISNINRKTIGAKQFRGPDPSVPAYR
FVRFDYIPPVNADYLSKIAKIMRQKEGFFLTASLKQDPKSRGTLLALEGPGASQRQFEIV
SNGPADTLDLTYWTDGTQHVISLEDVGLADSQWKNITVQVTGETYSLYVGCDLIDSFTLD
EPFYEQLRTEKSRMYVAKGSARESHFRGLLQNVYLVFENSAEDVLSQKGCQQSQGGYVPL
SNQQAGGAPKVAPEYAGPGAPRKPEVCEQSCEELGTMMAELAGLRVVVNELHENLRKVSN
DNQFLWELIGGPPKTRNMSACWQDGRFFAENETWVVDSCTKCTCKKFKTVCHQITCPPAT
CANPSFVEGECCPSCFRSLDGEEGWSPWAEWTECSATCGSGTQQRGRSCDVTSNTCLGPS
IQTRACSLGKCDHRIRQHGGWSHWSPWSSCSVTCGSGNITRIRLCNSPVPQMGGKNCKGS
GRETKGCQGVPCPIDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQHGGKDCAGDVRE
HQMCNRRSCPIDGCLSNPCFPGAQCNSFPDGSWSCGSCPVGFLGNGTHCEDLDECAVVTD
VCFTTSKAHRCVNTNPGFHCLPCPPRYKGTQPFGVGLEAARTEKQVCEPENPCKDKTHSC
HRHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNKNLVCATNATYHCIRDN
CPLLPNSGQEDFDKDGTGDACDDDDDNDGVDDEKDNCQLLFNPRQFDYDKDEVGDRCDNC
PYVHNPAQIDTDDNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCP
LVHNPDQTDVDNDLVGDQCDNNEDIDEDGHQNNQDNCPYISNANQADHDHDGQGDACDSD
DDNDGVPDDRDNCRLVSNPDQEDSDGDGRGDACRDDFDNDSVPDIDDVCPENSAISETDF
RNFQMVHLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTD
RDDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPTRAYGYSGVSLKVVNSTTGTGEHLR
NALWHTGNTQGQVRTLWHDPKNIGWKDYTAYRWHLTHRPKTGYMRVLVHEGKQVMADSGP
IYDQTYAGGRLGLFVFSQEMVYFSDLRYECRGG
Download sequence
Identical sequences M3Y5J6
ENSMPUP00000006597 ENSMPUP00000006597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]