SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006633 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006633
Domain Number 1 Region: 436-513
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.92e-23
Family Intermediate filament protein, coiled coil region 0.00038
Further Details:      
 
Domain Number 2 Region: 202-236
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000167
Family Intermediate filament protein, coiled coil region 0.0015
Further Details:      
 
Domain Number 3 Region: 249-314
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000471
Family Intermediate filament protein, coiled coil region 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000006633
Domain Number - Region: 327-436
Classification Level Classification E-value
Superfamily Prefoldin 0.000968
Family Prefoldin 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006633   Gene: ENSMPUG00000006687   Transcript: ENSMPUT00000006746
Sequence length 638
Comment pep:novel scaffold:MusPutFur1.0:GL897098.1:2157591:2177053:1 gene:ENSMPUG00000006687 transcript:ENSMPUT00000006746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRQVCKTSGGGSQGFSGRSAVVSGSSRMSCVARSGGTGGGACGFRAGAGGFGSRSLYSL
GGNKSISISVAGGSRAGGFGGGRSSCGSGFGGGYGGGFGGGFGGGRGMGGGFGGAGGLGG
AGGFGGAGGLGGLGGFGGVGGFGGAGGLGGAGGFGGPGGFGGPGGFGPGGFPGGIQEVTI
NQSLLQPLNVEIDPQIGQVKTQEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWNLLQQ
QGTNSMTGTNNLEPLFETYISNQRSYLDSILGERGRLDSELRNMQDLVEDFKKKYEDEIN
KRTAAENEFVTLKKDVDAAYMNKVELQAKVDALMDEINFLTNLYDMELSQMQSHVSDTSV
VLSMDNNRFLDLDSIIAEVKAQYEEIAQRSKAEAEALYQTKLGELQTTAGRHGDDLKSTK
SEIMELNRMLQRLRAEIENVKKQNANLQAAIAEAEQRGELALKDANAKLQELQAALQQAK
DDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRMSGECQSAVSISVVSSGGATSGS
AGGLGGGFGGGFGAGGGAGGFGGGRSSCGSGFGGGFGGGFGGGYGGGYGGGFGGGRGMGG
GFGGAGGLGGAGGFGGAGGFGGPGGFGLNSHSSQLKKK
Download sequence
Identical sequences M3Y5N2
ENSMPUP00000006633 ENSMPUP00000006633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]