SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006694 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006694
Domain Number 1 Region: 405-482
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 7.32e-24
Family Intermediate filament protein, coiled coil region 0.00039
Further Details:      
 
Domain Number 2 Region: 173-207
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000012
Family Intermediate filament protein, coiled coil region 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000006694
Domain Number - Region: 216-283
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000162
Family Intermediate filament protein, coiled coil region 0.01
Further Details:      
 
Domain Number - Region: 340-406
Classification Level Classification E-value
Superfamily Prefoldin 0.00602
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006694   Gene: ENSMPUG00000006748   Transcript: ENSMPUT00000006807
Sequence length 592
Comment pep:novel scaffold:MusPutFur1.0:GL897098.1:2237377:2414570:1 gene:ENSMPUG00000006748 transcript:ENSMPUT00000006807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRQFSSQSAFSSRCRRFYSTGSSAGSGGGSRAVGSVCQVRGRCGGGGGGGYGSHARGFG
SRSLYNLGGSKSISISLVGRSASGFCQGGGAGGRFGGGGRSFGGGGFGGGGFGGGGFGGG
GYGGGGFGGSNFGLGGFGPSCPPGGIQEVTINQSLLQPLHLEVDPEIQRVKTQEREQIMV
LNNKFASFIDKVRFLEQQNQVLQTKWELLQQVNTSTRTNNLEPILENYISELRRQVDFLN
TEQMRQNSEVRNMQDVVEDYKNKYEEEINRRANTENDFVVLKKDVDAAYMSKVDLESKVN
VLFGEISFLKYLFDMELSQMQTHISDTNVILSMDNNRFLDLDSIIDAVRTQYELIAQKSK
DEAEALYQTKYQELQISAGRQGDELKNSKMEIAELNRTIQRLQAEIGNVKKQCANLQNAI
ADAEQRGELALKDAKNKLAELEDALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLL
EGEECRLSGEGVGPVNISVITNSVSSAYGGGSGFGGGLGGGLGGGLGGGGSGSYYSSSSG
GVGMGGGLSVGSSGFSAGSGRSLGMGFGSGGGSSSSVKFVSTTSSSRKSFKS
Download sequence
Identical sequences M3Y5U3
ENSMPUP00000006694 ENSMPUP00000006694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]