SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006703 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006703
Domain Number 1 Region: 413-490
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 3.14e-23
Family Intermediate filament protein, coiled coil region 0.00036
Further Details:      
 
Domain Number 2 Region: 181-215
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000481
Family Intermediate filament protein, coiled coil region 0.0016
Further Details:      
 
Domain Number 3 Region: 225-291
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000994
Family Intermediate filament protein, coiled coil region 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000006703
Domain Number - Region: 303-410
Classification Level Classification E-value
Superfamily Prefoldin 0.00314
Family Prefoldin 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006703   Gene: ENSMPUG00000006757   Transcript: ENSMPUT00000006816
Sequence length 623
Comment pep:novel scaffold:MusPutFur1.0:GL897098.1:2258294:2263958:1 gene:ENSMPUG00000006757 transcript:ENSMPUT00000006816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRHFSSRSRFRSGGGFSSGSAGVVSFQRRSTSSSVRHSGGGGGRFSGGRCGGGGGGGGF
GSRSLVNLGGSKSISISVARGGGRGGFGSGYGGGGFGGGGFGGGGFGGGYGGGGFGGGGF
GGGGFGGSGFGGGGFGGGGFGGGSFGPVCPPGGIQEVTINQSLLQPLNVEIDPEIQKVKT
QEREQIKSLNNQFASFIDKVRFLEQQNQVLQTKWELLQQVDTSTRTHNLEPYFESYINNL
RRRVDQLKSDQSRMDSELKNMQDLVEDYRNKYEDEINKRTNAENEFVTIKKDVDAAYMTK
VDLQAKVDNLQQEIDFLTALYQAELSQMQTQISETNVILSMDNNRSLDLDSIIAEVKAQY
EEIAQKSKAEAEALYQTKYEELQITAGKHGDNLKSTKMEISELNRVAQRLRSEIDSVKKQ
ISALQQSISDAEQRGENALKDAQGKLAELEDALQKAKEDMARLLRDYQELMNTKLALDME
IATYRTLLEGEESRMSGECTPNVSVSVNTSHTTISGGSSRGGGGFGSGGGGSGGGYGSGG
GSYGSGGSSYGSGGGGGGSYGSGGGGGGGGYGSGSSSGGHRGGSWGSGGGSSGGRGSSSG
GTKTSSGSSSVKFVSTSYSRAVR
Download sequence
Identical sequences M3Y5V2
ENSMPUP00000006703 ENSMPUP00000006703 XP_004774734.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]