SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006713 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006713
Domain Number 1 Region: 87-292
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-59
Family DBL homology domain (DH-domain) 0.0000204
Further Details:      
 
Domain Number 2 Region: 277-399
Classification Level Classification E-value
Superfamily PH domain-like 2.57e-33
Family Pleckstrin-homology domain (PH domain) 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006713   Gene: ENSMPUG00000006767   Transcript: ENSMPUT00000006826
Sequence length 1215
Comment pep:known scaffold:MusPutFur1.0:GL896900.1:17625505:17727587:1 gene:ENSMPUG00000006767 transcript:ENSMPUT00000006826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVSASLRQDGSQERPVSLTSSTSSSGSSRDSRGAMEEPSGSGASAENGAGSPRGRHPPN
GNTSSSGWLSGRGPLSPFGGWSPAAPVHKLSYLGRVVREIVETERMYVQDLRSIVEDYLL
KIIDTPGLLKPEQVSALFGNIENIYALNSQLLRDLDSCNSDPVAVASCFVERSQEFDIYT
QYCNNYPNSVAALTECMRDKQQAKFFRERQELLQHSLPLGSYLLKPVQRILKYHLLLQEI
AKHFDEEEDGFEVVEDAIDTMTCVAWYINDMKRRHEHAVRLQEIQSLLINWKGPDLTIYG
ELVLEGTFRVHRVRNERTFFLFDKALLITKKRGDHFVYKGHIPCSSLMLIESTRDSLCFT
VTHYKHSKQQYNIQAKTAEEKRSWTHHIKRLILENHHTTIPQKAKEAILEMDSYYPSRYR
CSPERLKKAWSSQDEVSTHAQQGRRQSEPTRHLLRQLSEKGAARAAGMKEKGRRESEGPQ
SCRRSSGRSPTSAEKCMSFESTSPRPEVEPDPEPELEQEVFVAMEVPSIEEVPSDTESPE
VLETQLGAHQELLGLEPPGDMVGFVVAESTEDLKALSSEEEEDMGPTPDTESLLPPSVLD
QASVIAERFASSFSRRSSLALEDGKASGFGSPRLASRSSSVLSLEGSDKGPARPGSTTDA
LSLQPPPEVDSTVGVATDSGLSVNGLEPPSPGCPAEPDRPSCKRKASTLSTRDRLLLDKI
KSYYESAEHRDAGFSVRRRESLSYIPKGLVRNSVSRFNSLPRPDPEPMALPGHKRQVGSQ
PPSWALCDLPGAGQASAGESAPITDAEFRPSSEIVKIWEGMESSRESSLQGPGQGQANGF
DLHEPLFILEEHELGAITEESATASPESASPTEQPSPAHLARELKELVKELSSSVQGELV
TPLHPRIVQLSHVMDGPMSERVKNKVYQLARQYSLRIKSKSVTARPPLQWGKAAPTIPCL
QEEAGAPSGSRGKRKPVLSLLSDEQMVAQEHSPPKPGSPRHFSFSPTTASPRTTSPGARP
SSRSPLSPVDTETFTWPDVRELCSKYASHDEAFQAEGSRPRGPPVNRSRSAPENMVEPPL
VGRVGRCCSVGARRGQGGPEGAQLEPPGRLPQSRPVGEETLYVTADLTLENNRRVIVMEK
APLPCPVGGLEEGSGQGPHTPVATVGQGLDFQESGISRSPEYWQKEEGPRDPADPGQQGR
VRNLRKKFQALNSVG
Download sequence
Identical sequences M3Y5W2
ENSMPUP00000006713 ENSMPUP00000006713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]