SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006719 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006719
Domain Number 1 Region: 2092-2200
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.65e-16
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0057
Further Details:      
 
Domain Number 2 Region: 2518-2575
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000196
Family TSP-1 type 1 repeat 0.0005
Further Details:      
 
Domain Number 3 Region: 4200-4257
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000235
Family TSP-1 type 1 repeat 0.00045
Further Details:      
 
Domain Number 4 Region: 2946-3004
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000641
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 5 Region: 3984-4041
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000876
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 6 Region: 3219-3267
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000222
Family TSP-1 type 1 repeat 0.00046
Further Details:      
 
Domain Number 7 Region: 3793-3841
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000379
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 8 Region: 1554-1592
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000524
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 9 Region: 2791-2847
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000785
Family TSP-1 type 1 repeat 0.0004
Further Details:      
 
Domain Number 10 Region: 3612-3662
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000157
Family TSP-1 type 1 repeat 0.00051
Further Details:      
 
Domain Number 11 Region: 1687-1736
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000275
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 12 Region: 3925-3984
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000405
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 13 Region: 1261-1324
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000067
Family ATI-like 0.043
Further Details:      
 
Domain Number 14 Region: 1406-1443
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 15 Region: 3053-3110
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000392
Family BSTI 0.057
Further Details:      
 
Domain Number 16 Region: 2680-2721
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000405
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 17 Region: 2429-2465
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000628
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 18 Region: 3370-3431
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000693
Family TSP-1 type 1 repeat 0.00073
Further Details:      
 
Domain Number 19 Region: 3150-3210
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000759
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 20 Region: 4716-4765
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000811
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 21 Region: 3440-3487
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000017
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 22 Region: 455-515
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000245
Family ATI-like 0.063
Further Details:      
 
Domain Number 23 Region: 1442-1478
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000367
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 24 Region: 1366-1402
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000367
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 25 Region: 1484-1521
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000484
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 26 Region: 1803-1862
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000523
Family BSTI 0.055
Further Details:      
 
Domain Number 27 Region: 4567-4620
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000628
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 28 Region: 811-871
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000818
Family ATI-like 0.046
Further Details:      
 
Domain Number 29 Region: 2365-2404
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 30 Region: 2466-2518
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000157
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 31 Region: 2209-2247
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 32 Region: 4770-4827
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000621
Family BSTI 0.034
Further Details:      
 
Domain Number 33 Region: 4875-4940
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000719
Family ATI-like 0.016
Further Details:      
 
Domain Number 34 Region: 1742-1782
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000746
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 35 Region: 2598-2643
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000752
Family ATI-like 0.03
Further Details:      
 
Domain Number 36 Region: 1594-1629
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000838
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 37 Region: 3863-3911
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000942
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 38 Region: 4930-4997
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000126
Family VWC domain 0.059
Further Details:      
 
Domain Number 39 Region: 4265-4315
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000144
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 40 Region: 3007-3048
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000196
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 41 Region: 3282-3331
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000245
Family BSTI 0.052
Further Details:      
 
Domain Number 42 Region: 4377-4435
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000441
Family ATI-like 0.016
Further Details:      
 
Domain Number 43 Region: 2739-2787
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000445
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 44 Region: 2641-2698
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000471
Family VWC domain 0.042
Further Details:      
 
Domain Number 45 Region: 1899-1957
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000523
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 46 Region: 1647-1674
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000157
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 47 Region: 3497-3555
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000245
Family BSTI 0.055
Further Details:      
 
Domain Number 48 Region: 2847-2912
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000245
Family ATI-like 0.097
Further Details:      
 
Domain Number 49 Region: 911-966
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000262
Family ATI-like 0.074
Further Details:      
 
Domain Number 50 Region: 3761-3809
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000356
Family VWC domain 0.042
Further Details:      
 
Domain Number 51 Region: 861-929
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000565
Family Fibronectin type I module 0.07
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000006719
Domain Number - Region: 1955-2017
Classification Level Classification E-value
Superfamily FnI-like domain 0.000293
Family VWC domain 0.046
Further Details:      
 
Domain Number - Region: 958-1005
Classification Level Classification E-value
Superfamily FnI-like domain 0.000377
Family Fibronectin type I module 0.081
Further Details:      
 
Domain Number - Region: 4634-4678
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000491
Family ATI-like 0.018
Further Details:      
 
Domain Number - Region: 524-551
Classification Level Classification E-value
Superfamily PMP inhibitors 0.00889
Family PMP inhibitors 0.003
Further Details:      
 
Domain Number - Region: 3666-3723
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.011
Family BSTI 0.043
Further Details:      
 
Domain Number - Region: 4314-4373
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0131
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006719   Gene: ENSMPUG00000006773   Transcript: ENSMPUT00000006832
Sequence length 5101
Comment pep:novel scaffold:MusPutFur1.0:GL897015.1:457970:509629:1 gene:ENSMPUG00000006773 transcript:ENSMPUT00000006832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPALLFGTAWALANGRWCEHTETFLVEEEVTPRQEDRVPCTSLYHYQRLGWQLDLSWS
GRAGLCPIYKPPETRLAARNRTVRTCCPGWGGTRCTLALAEATPGGHCFGTRQCQLQAGS
ANASAGSLEECCAWPWGHSWWDGSSQACLSCSSRHLPGSAPSPAVLLPLAGAVAQFWSQR
QPPSATCATWSGFHYRTFDGRHYHFLGRCTYLLAGAADATWAVHLTPRGHCPQPGHCQLA
RVMMGPEEVLIQGRNVSVNGKLVPDGESQLLHGLSLQWQGDWLVLSGGLGVTVRLDGSSS
VSVSVDSELQGQTQGLCGVYNGQPEDDFLEPGGRLAVLAATFGNSWRLPDSEPGCLDSAE
VAQGCEGPLSSSEASMQADAQDVCYQLLDSPFRECHAQVPPAEYHQACLFAYCSGAPAGS
GREARREAVCSTLANYAQECAKQHIHVGWRKPGFCERLCPGGQLYSDCVSACPPSCSAVG
DRGQGSCREACVSGCECPPGLFWDGALCVPAARCPCYHRRRRYAPGDTVHQLCNPCVCQD
GRWLCAQAPCPAECAVGGDGHYLTFDGRSFSFRGSPGCRSSLVQDLKGQPLIVLEHGACD
AGSCLHAISVSLGDTHIQLRDSGAVLVDGQDVGLPWSGPKGLSVSRASSTFLLLRWPGAQ
VLWGVSDPAAYVTLDPRHARQVQGLCGTFTWNQQDDFLTPAGDVETSTAAFASKFQVAGE
GRCPSEDSALLFPCSTHAQRRVFAEAACAVLHGPTFQECQGLVDREPFHLRCLAAVCGCA
PGKDCLCPVLAAFARRCAREGALSLWRSQTLCPVPCPTGQEYQECAPVCGQNCGEPEDCE
ELGSCVSGCNCPPGLLRDPEGECVPPSLCSCQLGTQRYAPGSVTTKDCNHCVCQERGLWN
CSAQHCGPQRTFCPGDLVYVPGACLLTCDSPGTNHSCPPDSMGSCVCPPGTVLLHERCVP
PELCPCRHGGQWYPPNATIQEDCNVCVCQARQWHCTGHRCGGWCQASGAPHYVTFDGLAF
TFPGACEYLLVREASGRFTISAQNLPCGASGLTCTKALTVQLQSTVVHMLRGGRTVTVNG
VSITPPKVYTGPGLSLRRAGLFLLLTTRLGLSLLWDGGTRVLVRLSPQLHGRVSGLCGDF
DGDASNDLRSRQGVLEPTAELAAHSWHLSPLCPEPGDLPHPCTVNAHRASWARARCAVML
QPLFARCHAEVPPQQHYEWCVYDACGCDSGGDCECLCSAIATYADECARHGLSVRWRSQE
LCPLQCERGQVYEACGPMCPPTCHDHGPEPGWHCQAFACVEGCFCPEGTLLHGGVCLEPA
SCPCESGGSFFPPGTVLQKDCGNCTCKESQWLCGSNSSVCEEPEPGCVEGEAPCRESGHC
VPHRWLCDNQDDCGDGSDEEGCATPGCGEGQMSCRSGHCLPLALRCDGRDDCGDGTDEQS
CPCPHGSLACTDGRCLPLALLCDGHPDCPDAADEEACLAAGQLNCTPGELSCIDGSCVGA
VLLCDGIWDCPDGADEGPGHCSLPSLPAPPAGSLPGPSTGVGGMAPTPPASASPAPLCGP
LEFRCGSGECAPRGWRCDGEADCADGSDERGCGWLCALHQAPCARGPHCVSPAQLCDGVP
HCPDGSDEGRDACEGMTALGGPNGTRAPCPEFSCPDGLCISFQLVCDGQPDCESVGELGP
SPEEQGCGAWGPWSSWGPCSRTCGPGVQGRSRRCSPPGLPVLQHCPGPEHQTQACFTAAC
PVDGEWTPWSPWSLCTEPCMGTATRQRQCHPPQNGGRTCAMLPGDPPTTRQSRPCPQAGC
PNASCSGQLVFWPCAPCPLTCDEISGQVECAATRPCRSPGCWCPAGQVLDSEGRCVGPQQ
CPCLQDDTWYRPGQRIRANCQLCTCQDGRPQRCRPDPACSVNCGWSSWSPWGECLGPCGT
QNIQWSFRSPNNPRLSGQGRQCRGIHRKARRCRTEPCTSCEQQGRAHTVGERWREGPCRV
CQCLHNGTVRCSPYCPLGSCPQAWVLVEGVGGSCCHCAPPGENQTVHLLATPAPSPALSA
QIGPPLVTYVLPPPGDPCYSLLGLARLPEGSLKLEPPTQAVLLGAPTKRPGSQGRGTRRH
TRPPFLQLNLLRPRNLTGIMVQGAGASASLQFSSDGLHWHNYTDLVSPAKLSATNSDDGA
PTVRTFGRMVQAQHVRVWPHISHRDANHSISPRVELLGCAPVSPLEAPPCPGGGRRCAGA
ECAPRGEPCNGVKDCEDGSDEEGCTPPPTATGRVWSAATTPATTPAPTASTQPGPLPPQP
TEALAEAERWRPLRASPTPPTGRCPSESLGLLRVTGGELAGLNPPSPAPAGKGPVTWAPA
SEPPYVSRQPAAAVPTGQSVAPEPFPPARCSPGQVPCEVLGCVEQGQWCDGREDCLDGSD
ERHCASQAASPVPFTVPTMALAGLLASRAPCSPSQLSCGSGECLPAERRCDLRPDCQDSS
DEVGCVDCGLAPWSGWSGCSRTCGGLAFQRRELLRPPLPGGSCPSDRLRSQPCFVQACPV
AGAWADWGAWGPCSVSCGGGHRSRQRSCVDPPPKNGGAPCPGASHERAPCALQPCPGDAG
CGPGRVHVSAELCRKGLVPPCPPSCWDPEANRSCSGPCVEGCRCPPGLLLHDAHCLPLSE
CPCLVGEELKKPGAPFVLDNCSRCVCENGALLCEPGGCPVPCGWSAWSSWGPCDRSCGSG
VRVRFRSPSNPPAASGGAPCPCQDPCVEGLPFPPPERLGWTSWAPWSSCSQSCLAVGGGP
GWRSRSRFCPSSGNTSCPGEATQEEACSPPVCPVLSAWGLWAPWSACSAPCDGGVQIRGR
RCSGSTPGDPECQGPHSQTRDCNTQPCAAQCPGDMVFRSTEQCQRDGGPCPQLCLAQDPE
VECTSFCTSGCTCPPGLFLHNASCLPRSQCPCQLRGQLYAPGAQAQLDSCNNCTCVSGEM
ACTSEPCPVSCGWSPWTPWSVCSRSCDVGLRRRFRAGTAPPAAFGGAACQGPNMEAEFCS
LRPCRGPSGEWGPWSPCSVPCGGGYRNRTRGGGLNGRVDFSACGLQPCAGPVPGMCPRGK
RWLDCAQGPASCAELSAPQGTNQTCLPGCYCPSGTLLLNNVCVPSQDCPCAHGGRLYPPG
SVVLRLCENCSCVSGLITHCTSWPCEEGQPTWSPWTPWSECSASCGPARRHRHRFCSGPP
TMDPSALALPSPPTWPTPLCPGPDAEEEPCLLPGCDRAGGWGPWGPWSSCSRSCGGGLRS
RLRACDQPPPQGLGDYCEGPQAQGEVCQALPCPVTNCTAIQGAEYSPCGPACPRSCDDLL
HCVWHCQPGCYCPPGQVLSADGALCVSPSHCGCLDLLSGERHRPGARLPGPDSCNYCTCS
EGRLNCTDLPCPVPGGWCSWSEWTACSQPCRGQTRTRSRACACPAPQHGGTPCPGEAGGA
GAQHQKESCPTSPDCPGTADGVWSPWGPWSPCDPCVGQSQRSRECIWPPTPEGGRPCPGG
YRQSRPCQDNSTQCPATDCEGGQSLLPCGWACPRACQDLSPGSICQPGPAGCRPSCGCPP
GQLSQDGLCVPPARCRCHYQPGAMGIPENQSRSAGPGLSSWERLEPGEVVTGPCDNCTCM
EGTLQCREVPGCPGPGMWGSWGPWEDCSVSCGGGEQLRSRRCARPPCPGPARQSRTCHTQ
VCREAGCPAGRLYRECPPGEGCPFSCAHVTQQVGCFSAGCEEGCHCPMGTFQHRLSCVQE
CPCVLTAALLQELGTAGADPAARPPILGEGGQTLGPGDELGSGQSLRMGCRNCSCVHGRL
SCSMADCSKASDHFGPWGPWGPCSRSCGGLGTQTRSRQCAQPSPAPGSQGCGGPLQDLKY
CPSPDCPGTGAGGSTVEPVTSLPGGWGPWSPWSPCSHTCTDPTHPAWRSRTRLCLANCTS
GDPSQERPCNLPSCTELPPCSSPGCVAGNCSWTAWAPWEPCSRSCGVGQQRRLRAYRPPG
PGGHWCPDILTAYQERRFCNLRACPVPGGWSRWSPWSWCDRSCGGGRSLRSRSCSSPPPK
NGGAPCVGERHHARLCNPLPCGHGIPGGLCALHSSSLPTLIQLPQHLVMETLSDQLGKPG
PCSGRWQEAALGGSSLWRRQSPPVAHPLCPGPSFCPWLSLLSLATPASLPWAPPRSSTSG
SWAPECREEQSQSQPCPQPPCPPLCQHGARLHTLGDSWLQGECRQCSCTPEGIICQDVEC
AVPGAWTLWSPWSECPVSCGGGNQVRTRVCTGLAPSHRGTPCVGPDTQTQRCGWQPCLGL
LEACSWGPWGPCSRSCGSGLASRSGSCPCPLAEADHTCNGTFLHLDTQACYPGPCLEECV
WSSWSSWTRCSCQVLVQQRYRHQGPAPGAGQAGAGSACTRLDGHFRPCPTANCSGDSCTP
PFEFQACGSPCTGLCTTHLSHRLCQDLPPCQPGCYCPEGLLEQDGGCIPPEQCSCLHLAG
EGARLTLAPGDRLRLGCKECECQRGELQCTSQGCHGLLPLSGWSEWSPCGPCLPAGLLAP
ASRTALEERWSQHPAGPSPTLAPWLASEQHRHRLCLDPETGRPWAGDPELCTAPLSQQRL
CPDPRACHDLCQWSPWGPWSACQVPCSGGFRLRWREAGGPPGGGCRGPWAQTESCNVGPC
PGNPRDGIWGLPEGTRDPSCACWSRVVLVFPTPTPGCRCPPGQLIQDGLCVPISSCRCGL
PSPNASWVVAPGEVAQLGCNNCTCLNGSLMCPHRECPVLGPWSSWSSCSAPCGGGTMERH
RSCKEGPAGGPCEAQDTEQRRGCNLQPCPDCPPGQVLRACATTCPRLCSHLQPGAPCVQE
PCQLGCGCPGQQLLHNGTCVPPATCPCAQMSLPWGQTLPLEEQARELPPGTVLAWNCTRC
ICRDGAFNCSPADCHECPSGEMWQQVPPGELGPCERTCQEPNATETWGTCRMGQAPGCVC
RHGHLRSHAGHCVPPDHCECWRHGHPHPPGSEWQEACESCRCLHGRSVCTQHCPPLTCAQ
GEVTVQEPGSCCPTCRQETLEEQSASCRHLTELRNLTKGPCHLDQVEVSYCSGHCPSSTN
VMPEEPYLLSQCGCCSYSLDPESPVRVLTLRCPGGRTEPVVLPAIRSCQCSACLGGDFSK
H
Download sequence
Identical sequences M3Y5W8
ENSMPUP00000006719 ENSMPUP00000006719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]